KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_A2158
Entry
VCLMA_A2158       CDS       T01871                                 

Definition
(GenBank) GGDEF domain protein
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Pathway
vcl05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vcl00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VCLMA_A2158
Enzymes [BR:vcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VCLMA_A2158
SSDB
Motif
Pfam: GGDEF HAMP
Other DBs
NCBI-ProteinID: AEA79353
LinkDB
Position
I:complement(2468004..2469296)
AA seq 430 aa
MTDQTRTSPLVNRLLKMISLCALGYLLIILAIIIPRGIQSVEQQKQELEEKLALSLSNSA
AIALYVNNYDIASEVMDALLLHKEINAVKLASVDGIVFERTTMPTTYKEQNYWTDANRYR
LDSPVDGNLIGYLMIHEDHQVVRQQAINQILDQIAVVLIQFLVTFIALIWIVRRLVGKPL
TDLSQALSEVRPDHDRKVAVAAEDHHNEIGLVAKSINEFIDASHQALLRERELRQQIERW
ESYYRTIAKQDTLTGLKNRLGCEKFVLRKQRVSTSMVLLLIDLDGFKQVNDTLGHAAGDE
VLREIAKRFYALAQTHFSDFVVGRLGGDEFAIYIPLDEFVAESIERFAAQLIESSSEPIG
LGQQSAQVGCSIGISHMNSLHIDLEKLLLQADKAMYWVKYRGKHGYHIYRMGEEILPLPS
AKELKQDQFR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgactgatcaaacgcgaacttcgccactggttaatcgcttgctgaagatgatttcactg
tgtgcacttgggtatttgctgatcattttggccatcattattccacgcggcatacagagt
gttgagcagcaaaaacaagagctggaagagaagcttgcgctctctttgagtaactcggcg
gccattgcactgtatgtgaataattacgatattgcctccgaggtgatggatgcgctgctg
ctccataaagagatcaatgcggttaagttagccagcgtggatggcattgtctttgaacga
accaccatgcccacaacctacaaagaacagaattattggactgatgcgaaccgctaccga
ttagattctcccgtagatggtaatttgattggctatctgatgattcatgaggatcatcag
gtggttcgtcagcaagccattaatcagattcttgatcagatagccgtggttttgatccag
tttctcgtgacttttattgcgcttatctggatcgttcgccgcttggtcggtaaacccctg
acggatctttcacaggcgttatccgaagtgcggccagatcatgatcgcaaagtggcggta
gccgcagaagatcaccacaacgagattggtttggtggccaaaagcatcaatgaatttatc
gacgcttcccatcaagctttactgcgtgagcgcgagctgcgtcaacagattgaacgttgg
gaaagctactatcgcaccattgccaaacaagacacgctgacgggactaaaaaaccgttta
ggttgtgagaagttcgtgctccgcaaacagcgtgttagcaccagcatggtgctgctattg
attgatttggatggttttaagcaggtgaatgataccttgggacatgcggctggcgatgag
gtattacgtgaaatcgccaaacgtttttatgccttggcgcaaacacatttttctgatttt
gtggtcggacggctcggtggtgatgagtttgctatttacattccgctggatgaatttgtt
gccgaatctatcgagcggtttgcggctcagttgatcgaatcctcctctgagccgattgga
ttgggtcagcagagtgcgcaagtgggttgcagtatcgggattagtcatatgaacagtctg
cacattgacttagaaaaactgctgctacaagccgataaagccatgtactgggtcaaatac
agaggcaaacatggctatcatatttatcgaatgggggaagagatcctgcctcttcccagt
gcgaaagaactcaagcaggatcagttcagatag

DBGET integrated database retrieval system