KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_B0369Help
Entry
VCLMA_B0369       CDS       T01871                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Pathway
vcl00473  D-Alanine metabolism
vcl00550  Peptidoglycan biosynthesis
vcl01100  Metabolic pathways
vcl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vcl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VCLMA_B0369
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VCLMA_B0369
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VCLMA_B0369
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcl01011]
    VCLMA_B0369
Enzymes [BR:vcl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VCLMA_B0369
Peptidoglycan biosynthesis and degradation proteins [BR:vcl01011]
 Precursor biosynthesis
  Amino acid ligase
   VCLMA_B0369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_YheCD Glutaminase
Motif
Other DBs
NCBI-ProteinID: AEA80008
LinkDB All DBs
Structure
PDB: 

Position
II:complement(405074..405991)
Genome map
AA seq 305 aa AA seqDB search
MTKTTILLLCGGGSSEHEISLVSANYIQQQLELTPEFHVIRVEMKKEGWFSEQGALVYLD
TNSATLNSDKASYPIDFVVPCIHGFPGETGDIQSMLELAGIPYLGCGPEASANSFNKITS
KLWYDALGIPNTPYLFLTQNTPSSIEKAKQAFGHWGSIFVKAARQGSSVGCYKVTTEVSA
YEMNGKLYISKPGEVIAPEGTFYSYEEKYSANSHARTVLEAENLTEKHKELIQTYAERVF
IHMKLRHLSRIDFFLTQEGQIYLNEVNTFPGMTPISMFPKMLEHNGHRFSEFLVQCVTNT
LVNAK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacaacaatcctacttttgtgcggtggcggctcatctgagcacgaaatttct
ctcgtatcagccaactacatccaacaacagcttgaactgactccagagtttcacgtgatt
cgagtcgagatgaaaaaagagggatggttttccgaacaaggagccctcgtatacctcgat
acaaatagcgcaacattaaatagcgataaggcttcctacccaatagattttgttgttcct
tgcatccatggtttcccgggagaaactggggatattcaatccatgttagaactggcaggc
attccttatctaggctgtgggccagaagccagtgcaaacagttttaacaaaatcacgtcc
aaactgtggtatgacgcattaggtattcctaacacaccgtatttatttttaacccaaaat
acaccaagctcgattgaaaaagccaagcaagcttttggtcattggggaagtatctttgtc
aaagcagctcgtcagggttcttcagtcggatgctacaaagtaaccacagaggtttctgct
tatgagatgaacggaaaactctatatctcaaagccgggagaagtgattgcaccagaaggt
acattctattcatatgaagaaaagtacagtgcgaatagccacgccagaaccgtcttagaa
gctgaaaatctaaccgagaaacacaaagaattaattcaaacatatgctgaacgtgtattc
atccatatgaagcttcgtcatttatctcggatcgactttttcttgactcaagagggacaa
atttatctcaatgaggtcaatacatttccaggaatgacaccgatttccatgtttccgaaa
atgctagagcacaacggacatcgatttagtgaattcctcgtgcaatgtgtcaccaacaca
ttagtaaatgcgaaatag

DBGET integrated database retrieval system