KEGG   Vibrio cholerae O1 M66-2: VCM66_1969Help
Entry
VCM66_1969        CDS       T00891                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vcm  Vibrio cholerae O1 M66-2
Brite
Enzymes [BR:vcm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VCM66_1969 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACP06272
UniProt: C3LNZ6
LinkDB All DBs
Position
I:2140210..2140794
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFENKSLEEIIKTS
TGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGAVAEAINAAFGSFADFKAKFTDSAINNFG
SSWTWLVKKADGTLAITNTSNAATPLTEEGVTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAQNLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattacccgctcttccttatgcgaaagacgcactggaaccacacatctca
gcagaaactctggatttccaccacggtaagcaccacaacacttatgtggtaaaactgaac
ggtctgatcccaggtactgagtttgaaaacaaatcactagaagagatcatcaagacctca
actggcggtattttcaacaacgctgcgcaggtttggaaccacactttctactggcactgc
ctatcaccaaacggtggtggcgagccaactggcgcagttgctgaagcaatcaatgcagca
ttcggttcttttgctgacttcaaagcaaaatttactgattcagccatcaacaacttcggt
tcatcttggacttggttggtgaaaaaagctgacggcactctggcgatcactaacacttca
aacgcagcaacaccgctgactgaagaaggtgtaacccctctgctgacggttgacctgtgg
gaacacgcgtactacatcgactaccgtaacgtacgtccagattacatgaatggtttctgg
gctctggttaactgggacttcgttgctcagaacctagcaaaataa

DBGET integrated database retrieval system