KEGG   Vibrio cholerae O1 M66-2: VCM66_2678Help
Entry
VCM66_2678        CDS       T00891                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm00071  Fatty acid degradation
vcm00280  Valine, leucine and isoleucine degradation
vcm00281  Geraniol degradation
vcm00310  Lysine degradation
vcm00362  Benzoate degradation
vcm00380  Tryptophan metabolism
vcm00410  beta-Alanine metabolism
vcm00640  Propanoate metabolism
vcm00650  Butanoate metabolism
vcm00903  Limonene and pinene degradation
vcm00930  Caprolactam degradation
vcm01100  Metabolic pathways
vcm01110  Biosynthesis of secondary metabolites
vcm01120  Microbial metabolism in diverse environments
vcm01130  Biosynthesis of antibiotics
vcm01200  Carbon metabolism
vcm01212  Fatty acid metabolism
Module
vcm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    VCM66_2678 (fadB)
   00650 Butanoate metabolism
    VCM66_2678 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VCM66_2678 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VCM66_2678 (fadB)
   00310 Lysine degradation
    VCM66_2678 (fadB)
   00380 Tryptophan metabolism
    VCM66_2678 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VCM66_2678 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VCM66_2678 (fadB)
   00281 Geraniol degradation
    VCM66_2678 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VCM66_2678 (fadB)
   00930 Caprolactam degradation
    VCM66_2678 (fadB)
Enzymes [BR:vcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VCM66_2678 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VCM66_2678 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VCM66_2678 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     VCM66_2678 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ACP06970
UniProt: C3LSI3
LinkDB All DBs
Position
I:2873698..2875869
Genome map
AA seq 723 aa AA seqDB search
MIYQAKTLQVKQLANGIAELSFCAPASVNKLDLHTLESLDKALDALAADSSVKGLLLSSD
KEAFIVGADITEFLGLFAKPEAELDEWLQFANRIFNKLEDLPFPTLSALKGHTLGGGCEC
VLATDFRIGDATTSIGLPETKLGIMPGFGGTVRLPRLIGADSAMEIITQGKACRAEEALK
VGLLDAIVDSDKLIDSAITTLTQAIEEKLDWQKRRQQKTSALTLSKLEAMMSFTMAKGMV
AQVAGKHYPAPMTSVVTIEEAARLPRDAALDIERKHFIKLAKSTEAQALVGIFLNDQYIK
GLAKQSAKAASQDTQHAAVLGAGIMGGGIAYQSALKGVPVLMKDIAPHSLELGMTEAAKL
LNKQLERGKIDGFKMAGILASITPSLHYAGIDQADVIVEAVVENPKVKAAVLSEVEGLVD
TETILTSNTSTIPINLLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEHTSEDTINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFAGFSLLMRDGANFTEIDKVMERQFGWPMGPAY
LLDVVGIDTAHHAQAVMAEGFPTRMAKSGREAIDALYEAKKFGQKNGSGFYQYTVDKKGK
PKKAFSDDVLAILAPVCGAPQSFDPQTLIERTMIPMINEVVLCLEEGIIASAQEADMALV
YGLGFPPFRGGVFRYLDTIGIANYVAMAEKYADLGALYQVPQLLKNMAQQGTSFYSAQQV
SAL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccaaaaccctacaggtaaagcaactcgctaatggaattgccgagctc
tctttctgtgctcctgcttccgttaacaaactggatttacacacactggaatccctcgat
aaagcgttagatgcgctcgctgccgattccagcgtcaaaggcctcctactcagctcagat
aaagaggcttttatcgtcggcgctgatatcaccgaatttctcgggctatttgccaagccg
gaagcagaattggatgagtggttgcagtttgccaatcgcatttttaacaagttggaagat
ttacctttccccaccttatcagcgttaaaaggccatacacttggcggcggctgtgaatgt
gtactcgccaccgattttcggattggtgatgccaccaccagcattggcttgcctgaaacc
aaactgggcatcatgccgggatttggcggcaccgtgcgtctgccacgtttgattggcgct
gatagcgcgatggaaatcatcacccaaggtaaagcgtgccgcgcggaagaagcgttaaaa
gtgggattactggatgcgattgtcgatagcgacaaactgatcgattccgcaatcaccact
ttgactcaagcgattgaagaaaaactggattggcaaaaacgccgtcagcagaaaacctca
gcgctgactctaagcaagctggaagccatgatgagctttaccatggcaaaaggcatggtg
gcgcaagtggcaggcaaacactatccagcaccgatgacatctgtcgtgaccattgaagaa
gcggcgcgtttaccacgcgatgctgcgctggatatcgagcgcaaacacttcatcaagctc
gcaaaatctaccgaggcacaagcgctggttggtattttcctcaatgatcaatacatcaaa
ggtctagccaaacaatccgcgaaagcggcaagccaagacacccaacacgccgccgtgctc
ggcgcgggcattatgggcggcggcatcgcctatcaatcggctctcaaaggcgtacctgtg
ctgatgaaagacatcgcaccgcactctttagaactgggcatgaccgaagcggccaagctc
ctcaacaaacagttagagcgcggcaagatcgatggtttcaaaatggctggcattctggct
tccatcaccccttctctgcattacgctgggattgatcaggcggatgtgattgttgaggcc
gtggtggaaaatccgaaagtaaaagccgcggtactgagcgaagtggaaggattggtcgat
acagaaacaattctgacctccaacacctcgaccattcccattaacctgctcgccaaatca
ctcaagcgcccacagaacttctgcggtatgcacttctttaaccctgtgcatcgcatgcct
ttggtggaaatcatccgtggtgaacacacctcagaagacaccatcaaccgagtggttgct
tatgcggcgaaaatgggcaaatcaccgattgtggtcaatgattgcccaggattcttcgtt
aaccgcgtactcttcccttactttgcaggctttagcctactgatgcgtgatggtgcaaac
ttcaccgaaatcgacaaagtgatggagcgtcaattcggctggccaatgggcccggcgtat
ttgcttgatgtggtcggcattgatactgcacaccatgctcaggcagtgatggcggaaggc
ttcccaactcgcatggcgaaaagcggccgagaagcgattgatgccctgtacgaagcgaaa
aaatttggccagaaaaatggcagcggcttctatcagtacaccgttgataaaaaaggcaaa
ccgaaaaaagccttcagcgatgacgtgctcgccattcttgcgcctgtatgcggcgcacca
caaagctttgacccacaaacccttattgaacgcactatgattccgatgattaatgaagtg
gtgctctgtcttgaagaagggatcatcgcctccgcgcaagaagctgacatggcgttggtg
tacggtcttggcttccctccgttccgtggtggtgtattccgttacttagataccataggc
atcgccaactatgtggctatggcggaaaaatacgctgacctcggcgcgctctatcaagta
ccgcaactgctgaagaacatggcgcaacaaggaacatctttctacagcgctcagcaagtc
agtgccctgtaa

DBGET integrated database retrieval system