KEGG   Vibrio cholerae O1 M66-2: VCM66_A0246Help
Entry
VCM66_A0246       CDS       T00891                                 

Gene name
amy1
Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm00500  Starch and sucrose metabolism
vcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VCM66_A0246 (amy1)
Enzymes [BR:vcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VCM66_A0246 (amy1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase UxuA Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: ACP07225
UniProt: C3LUS0
LinkDB All DBs
Position
II:complement(270128..271528)
Genome map
AA seq 466 aa AA seqDB search
MKSSYVVLCATFAAASFTSSVQAEAILHAFNWKYADVTANAAQIAAAGYKKVLISPALKS
SGNEWWARYQPQDLRVIDSPLGNKTDLQTLIKTLQDYGVEVYSDVVFNHMANESWKRSDL
NYPGSEVLASYTNQAYYYQQQKLFGDLSHNLFSQNDFHPEGCITDWGNPGHVQYWRLCGG
AGDRGLPDLDANAWAINQQRAYLQALKQMGIRGFRIDAVKHMSQYHIDQVFTPEIISGMH
VFGEVITSGGQGDGSYDAFLAPYLNNTTHAAYDFPLFASIRAAFSYQGSMSQLHDPQAYG
QALPNARAITFAITHDIPTNDGFRYQILNPQDEQLAYAYLLGKDGGTPLIYSDDLADHED
KDNGRWANVWNQPSMQHMLRFHNAMQGKPMTVMYSDSCLLLFKRGKEGVVGINKCGESKN
VTIDTYQHEFNWYQTYQDTLSDDRFSVSSRYHTLTIPARVARMWML
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatcgtatgttgttctttgtgccacattcgcggcagcaagttttactagcagc
gtacaagcagaagccattttgcatgcttttaactggaaatatgcagatgtcactgcgaat
gcagcacagatcgccgccgcaggttataaaaaagtgctgatctcaccagcattgaaatcc
agcggcaatgaatggtgggctcgttaccaacctcaagatctgcgagtcattgactcacct
cttggcaacaaaaccgacttacaaacactgatcaaaacgctgcaagattacggtgttgaa
gtatattcggatgtggtgtttaaccatatggcaaacgaaagttggaagcgtagtgatctc
aattatccgggcagcgaagtactagccagctacactaaccaagcttattactatcaacaa
cagaaactgttcggtgatttgtcgcacaatctcttctcacaaaatgatttccatcctgaa
ggttgtattactgattggggcaaccccggtcatgttcagtattggaggctatgcggtggc
gcaggtgatcgcggtctaccagacttggatgccaacgcttgggccatcaatcaacagcga
gcctatttacaagcgcttaagcaaatgggtatcagaggatttcgaattgatgcggttaag
cacatgagtcaataccacattgaccaagtcttcacaccagagattatttcgggcatgcat
gtgtttggcgaagtgatcacaagtgggggtcaaggtgatggcagttatgatgccttccta
gctccttatctgaataacaccacacacgccgcatacgactttcctctatttgcctccatt
cgtgccgcattttcttatcaaggttcgatgagtcaattgcatgatccacaagcctatgga
caagcattaccaaacgcccgcgccatcacgtttgcgattacccatgatattcccactaat
gatggattccgttatcagatcctcaacccgcaagatgagcaactcgcttacgcttatcta
ctcgggaaagatggtggaacaccgctgatttatagtgatgatctggctgatcacgaagat
aaagataatggtcgttgggcgaatgtttggaatcaaccatcaatgcaacatatgctgcgc
ttccataacgcaatgcaaggtaaacctatgacggttatgtatagcgactcatgtttgctg
ctcttcaaacggggtaaggaaggtgtcgtaggtattaataaatgtggtgagtcaaaaaat
gtcaccatagatacttatcagcatgaatttaactggtatcagacctatcaagatacttta
agtgacgaccgttttagcgtgagcagtcgctaccatacgttaactatcccagcacgtgtt
gcgcgcatgtggatgctgtaa

DBGET integrated database retrieval system