KEGG   Vibrio cholerae O1 M66-2: VCM66_A0615Help
Entry
VCM66_A0615       CDS       T00891                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm00564  Glycerophospholipid metabolism
vcm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VCM66_A0615 (glpD)
Enzymes [BR:vcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VCM66_A0615 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 3HCDH_N Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ACP07577
UniProt: C3LVS2
LinkDB All DBs
Position
II:566960..568498
Genome map
AA seq 512 aa AA seqDB search
MNARSTRFTQDEVLDLIIVGGGINGAGIAADATGRGLKVGLYDAKDFASATSSASSKLVH
GGLRYLEHYEFRLVSEALAEREVLLKKAPHIVTPMRFRLPHRPFLRPAWMIRAGLFLYDN
LGKRTSLPASHKVNLKAGSVTKPEMQIGFEYSDCWVDDARLVILNAMQAQEQGAEVLNYC
TVEKAERMGDLWHVTLLDEQTQQRFERRSHALVNAAGPWVKQFLNENAHVSSPYGIRLIQ
GSHIIVPRIHDEPQAYILQNEDKRIVFVIPYLDDYSMIGTTDVEYKGDPRKVAITDAERD
YLISIVNKHFMREIARSDIIAEFSGVRPLCDDESNSPQAITRDYTLSLDQQADEAPLLSI
FGGKLTTYRKLGEAAMKHLAPFFPKMKAPWTADAPLPGGENFDYAALKNQLVAAFPFITE
SVIERWLRSYGSRTTQLLAGVTGIEDLGIAFSGELYQREIDYLCEKEFARHAQDIFWRRS
KLGLNHDTSVVEEVESYLQQKFHAEQPLKATV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcgctcaacacgttttacccaagatgaagtgctcgatttgattattgttggc
ggtggcattaatggcgctggcattgccgcagatgcaacagggcggggattaaaagttggc
ttatacgatgccaaagattttgccagtgcaacctcttccgccagctcaaaactggtacac
ggtggtttgcgctatttagaacattatgaatttcgcttagtcagtgaagcactggcggaa
cgcgaagtgcttttgaaaaaagcaccgcacatcgtaacgccgatgcgttttcgtttgcca
catcgtcctttcttacgcccagcatggatgatccgcgctggtctgtttctttatgataat
ttgggcaaacgcacttccctacctgcaagtcacaaagtcaacttaaaagcgggcagcgtg
actaaacctgaaatgcaaattggttttgagtattccgattgctgggttgatgatgctcgt
ttagttatcctcaacgccatgcaagctcaagaacaaggggcagaagtgttgaactactgc
accgtcgaaaaagctgagcgtatgggcgatttgtggcatgtgacgctactggatgagcag
actcaacaacgctttgagcgccgtagtcatgcacttgtgaatgccgcaggcccttgggta
aagcagtttttaaacgagaatgctcacgtcagttccccttacggcattcgtttaatccaa
ggctcacacattatcgtgccgcgcattcacgatgagccgcaggcctatattctgcaaaat
gaagataaacgtattgtcttcgtcatcccttatcttgatgactactcgatgattggcaca
acggatgtcgaatacaaaggcgacccaagaaaagtggcgattaccgatgctgagcgtgat
tatttgatttcgattgtgaacaaacattttatgcgcgaaatcgcgcgttcagacatcatt
gctgaattcagtggtgtacgcccactgtgtgatgacgaatcgaactcgccacaggccatt
actcgtgactatacactgtctctggatcaacaagctgatgaagcgccgctgctgtccatt
tttggtggcaaactcacgacgtatcgcaaactaggcgaagcggcgatgaaacatctcgct
cctttcttcccgaaaatgaaagccccttggacagcggatgctcctctgccaggtggtgaa
aactttgactatgcagccttaaaaaaccagctggtggcggcctttccttttattactgag
tcagtgattgagcgttggctccgcagctatggcagccgcaccacgcaacttttggcaggt
gtgacaggcattgaagatctcggcatcgcgttcagcggtgagctctaccaaagagagatc
gattatctgtgcgagaaagagtttgcccgccatgcacaagatattttctggcgcagaagc
aaactcggcttaaatcacgatacaagtgtggttgaggaagtggagtcctatttacagcag
aaattccacgctgagcagccgctaaaagcgaccgtttaa

DBGET integrated database retrieval system