KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_103673
Entry
VOLCADRAFT_103673 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K22464  fatty acid photodecarboxylase [EC:4.1.1.106]
Organism
vcn  Volvox carteri f. nagariensis
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VOLCADRAFT_103673
Enzymes [BR:vcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.106  fatty acid photodecarboxylase
     VOLCADRAFT_103673
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C NAD_binding_8 DAO Lycopene_cycl Pyr_redox_3 Pyr_redox_2 Pyr_redox
Other DBs
NCBI-GeneID: 9621234
NCBI-ProteinID: XP_002948047
JGI: 103673
UniProt: D8TNQ4
LinkDB
Position
Unknown
AA seq 613 aa
MLLGQRPFGAPAKGAMPCWKAARHGGVAGVARRPVAVKAAASVGSEKFDYILVGGGTAGC
VLANKLSANGSKKVLVLEAGPTGDAMEVAVPAGIARLFAHPVFDWGMSSLTQQQLVAREI
YLARGRLLGGSSGTNATLYHRGTPADYDSWGLEGWTSKDLLDWFVKAECYGDGPRAFHGQ
SGSMNVEQPRYQNVLHDEFFRAAAAAGLPANEDFNDWSRPQEGYGEFQVAQKNGERADTY
RTYLKPAMGRDNLKVMTGARTTKVHIEKSSTGPRARGVEYATQQFGERYTAELTPGGEVL
MCTGAVHTPHLLMLSGIGPAPTLLEHGLDVISSLPGVGANLQDHPAAVLAVRAKPEFEGL
SVTSEIYDSKCNIRLGAVMKYLFGRRGPLATTGCDHGAFVRTSASHSQPDLQMRFVPGCA
LDPDGVKSYIVFGELKKQGRAWPGGITLQLLGIRAKSRGSIGLKAADPFINPAININYFS
DPEDLATLKNGVRIAREIVAQEPLRKYLLEETFPGERANTDKDIEEYVRRTVHSGNALVG
TCAMGTTPASGAVVSSADLKVFGVDGLRVVDASVLPRIPGGQTGAATVMVAERAAAMLLG
QATITSRREPAAV
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgttgctaggtcaacgaccttttggtgcgcccgcaaagggtgcgatgccatgctggaag
gctgctcggcacggtggggtcgcaggtgttgctcgtcgtccagttgcagtcaaagctgcg
gcaagcgtggggtcggagaagttcgactacatccttgtgggaggagggacggcaggttgc
gttctggcaaacaaattgtccgctaatggcagcaagaaggttcttgttcttgaggctggt
ccaaccggcgatgctatggaagtggccgtaccggccggtattgcccgtctctttgcacat
ccagtttttgactggggtatgtccagtttgacgcagcagcagctggttgcacgcgagatc
taccttgctcgcggtcgccttctgggcggttcctctgggaccaacgcaacgctgtatcat
cgcggcacccccgctgactacgacagttggggcttggagggctggacgagcaaggatcta
cttgattggttcgttaaggccgaatgctatggagacggtccccgggccttccatggccag
tccggttctatgaatgtggagcaaccgcgttaccagaacgtcctgcacgacgagtttttc
agggctgctgcggcagctggattacctgccaacgaggatttcaatgactggagccggccg
caggagggctatggggagttccaggtggcccagaagaacggtgagcgcgcggacacgtat
cggacctacctcaagccggctatgggccgcgacaacctgaaggtgatgaccggcgcgcgt
acgaccaaagtgcatatcgagaagagctcgacgggtccacgtgcccgcggtgtcgagtat
gctacccagcaatttggggagcgctacaccgccgagctgactcctggtggcgaggttctc
atgtgcaccggtgccgtgcacacaccgcacctactgatgctttcgggcattgggccggcg
ccgaccctccttgagcacggactcgacgtgatatcaagcctgcctggcgtgggtgccaac
ctgcaggatcacccagccgcggtgcttgctgtccgggctaagcccgagttcgagggactg
tcggtcacttcggaaatctatgacagcaagtgcaacatccggttgggcgccgttatgaag
tacctgttcggacgccgcgggccacttgcaaccacaggctgtgatcatggcgcttttgtg
cgcacttcggcctcgcattcgcagccggacctgcagatgcgattcgtgcccggttgcgcg
ctggaccccgacggcgtgaagtcgtacattgtgttcggcgagctgaagaagcagggccgt
gcttggcccggcggtatcacgttgcagctgctgggcatccgcgccaagagcaggggcagc
atcggtctcaaggccgcggatcccttcatcaaccccgccattaacataaactatttctcc
gatcctgaggaccttgccacgcttaagaacggtgtgcgcattgcgcgcgaaatcgttgcc
caggagccattgcgcaaataccttctggaggagaccttccccggggagcgggcgaacact
gacaaggacattgaggagtatgtccggcgcacggtccacagcggcaacgcgcttgtgggc
acctgcgcgatgggtaccacgccagccagtggcgccgtggtgtcttctgctgacctcaag
gtgttcggtgttgacgggctgcgtgtcgtggatgcgtctgtgctgccacgcattccaggc
gggcaaacaggagcggccactgtcatggttgcagagcgggcggcggccatgctgcttgga
caggcgacgattacttctcgtcgcgagcctgcggctgtttag

DBGET integrated database retrieval system