KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_74298Help
Entry
VOLCADRAFT_74298  CDS       T01330                                 

Gene name
sdh1
Definition
(RefSeq) succinate dehydrogenase subunit A, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00020  Citrate cycle (TCA cycle)
vcn00190  Oxidative phosphorylation
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
vcn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VOLCADRAFT_74298 (sdh1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VOLCADRAFT_74298 (sdh1)
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VOLCADRAFT_74298 (sdh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO DUF2117
Motif
Other DBs
NCBI-GeneID: 9618803
NCBI-ProteinID: XP_002949632
JGI: 74298
UniProt: D8TTD9
LinkDB All DBs
Position
Unknown
AA seq 641 aa AA seqDB search
MSVLAKLLTGTAAKAQSTQLGLLGQRSILATAQQTALPELRGYASQTYPVIDHQYDAVVV
GAGGAGLRAAVGLSELGFKTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTV
KGSDWLGDQDAIHYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAY
RCACAADRTGHAMLHTLYGMAMKHNIQFFVEYFALDLMMDSDGACRGIMALCMEDGTIHR
FQAHQTVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDLEFVQFHPTGIYGAGCL
ITEGCRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGCGPEKDHIYL
HLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYMGEVLAPTK
ENPDKVVPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANRVGEIMKPNTPHKPLP
ASAGEHAIARLDKLRNAKGNLRTAEIRRNMQKVMQNNAAVFRTQETLAEGCKLIDECAAS
FSDVKVTDRGLVWNTDLVETLELENLLLNAAITMHGAEQRKESRGAHAREDFTERDDAKW
LKHTLGYMPSVENKVSISYRPVHMQPLSEEMPYIPPKARVY
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtactagctaagcttctgaccggcacagctgccaaagcgcagtctacgcaatta
ggattgcttggacagcggtcaatcttggctacagcccagcaaacagcactgccggagttg
cgggggtacgcttcccagacctatcccgttatcgaccaccaatatgacgctgtggtggtc
ggtgctggtggagctggcttacgcgctgctgttgggctgtcggagctcggcttcaagaca
gcgtgcgttacgaaattgtttcccacgcgctctcacacggtagcagctcagggtggcatc
aatgccgctctgggcaacatgacggaagacgattggcgctggcacgcttacgacacagtt
aagggcagcgactggcttggcgaccaggatgctattcattacatgtgccgtgaagcacca
aaggcagttatcgagctggagaactacggcctgcccttttcgcgcaccgaagatggaaag
atttaccagcgcgccttcggaggccaaagccttgactttggcaagggtggacaggcgtat
cgttgtgcttgcgctgcggatcgtacaggacacgccatgcttcacaccctctatggaatg
gcgatgaagcacaacattcagtttttcgttgagtacttcgccctggatcttatgatggac
tcggacggcgcctgtcggggcatcatggcgctgtgcatggaggacggcaccatccaccgc
ttccaagctcaccagaccgtcctcgctacgggcgggtacggccgcgcttacttctccgcc
acctcggctcatacctgcaccggcgacggtggtggcatggttgcccgtgctggcctgcct
ctccaggacctggagttcgtgcagttccaccccaccggcatttacggcgcgggctgtctt
atcacggagggctgccgtggcgagggcggcatcttgcgcaacagcgagggcgagcgcttc
atggagcgctatgcacctacagccaaggacttggcgtctcgtgacgtggtgtcccgctca
atgaccattgaaattcgggagggccggggttgtggtccggagaaggatcacatctacctg
cacctgaaccacttgccgccggagctgctggcggagcgactgcctggtatcagtgaaacg
gctgctatcttcgcgggcgtcgacgtcaccaaggagcccatcccggtgctgcccacggtt
cactacaacatggggggcataccgaccaactacatgggcgaggtgctggctcccaccaag
gaaaacccggacaaggtggtgcccgggctgtttgccgcgggagaggcagcctgcgcgtcc
gtacacggcgcgaaccgcctgggcgccaactcgctgctggacattgtggtctttggacgc
gcatgcgccaaccgcgttggcgagattatgaagcccaacacaccgcacaaaccgctacca
gcaagcgccggtgagcacgctatcgcgcgactggacaagctgcggaacgccaagggcaat
ttgcgcaccgcggaaatccggcgcaacatgcagaaggtgatgcagaacaacgcggcagtg
ttccgtacccaggagacgttggcggagggctgcaagctgattgacgaatgcgccgcatcg
ttctcagacgtcaaggtgacggaccggggtctagtttggaacacggatctagtcgagacc
ttggagctagagaatctgctgctcaacgctgccatcaccatgcacggtgcagaacagcgc
aaggagagccgcggagcacacgcgcgcgaggactttaccgagcgcgacgacgccaagtgg
ctcaagcacacgcttggctacatgccgtcggtcgaaaacaaggttagcatctcgtaccgc
cccgtacacatgcagccgctgagtgaggagatgccgtacattcctccgaaggcccgcgtg
tactga

DBGET integrated database retrieval system