KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_80593Help
Entry
VOLCADRAFT_80593  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00564  Glycerophospholipid metabolism
vcn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VOLCADRAFT_80593
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VOLCADRAFT_80593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA HI0933_like NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 9623894
NCBI-ProteinID: XP_002949314
JGI: 80593
UniProt: D8TSE3
LinkDB All DBs
Position
Unknown
AA seq 676 aa AA seqDB search
MPLLFLKSYLPVAAAAGAFAAVGGAGYLLSQQHQQPLWARGGPQPDEAEAVELLERPPPR
PTQLERLRGSTRDRPFDVLIVGGGATGSGCALDAVTRGLRTALVERDDFGSGTSSKSTKL
VHGGVRYLEKAVFQADIRQLRLVYEALHERATMLALAPNLAAPRAILTPCYKWWEVPYYW
AGLKAYDLVAGRANLISSRYVPPAEALDMVPTLATSHSDGSTLKGAVLYYDGYFDDARFN
VALACTAAAAGGVVANYVDCKQLIKNQDGKVVGAVVQDRLGSEPPFEVYARVVLNTTGCF
VDEVRHLSRPDALPIIQPSSGAHITLPAFYGGHTRNGIIIPKTKDGRVVFMLPFLDSVIA
GTTDSKCHVTRNPVATRQEVDFILGELQDYLGIQVRPSDVLSVWSGIRPLAADPRAKDTQ
NTVRDHVIVEEGDGLLTASGGKWTTYRLMAQEAVDAVVATGRMPTNVKACRTTGIPLLGA
GPEYSNTLAAQLAQDFGPLAAHIAPDAAAASLTPTAPTASFKTTSAAAAAATPPRVVIDA
QTAEHLAQAYGTRAGRVLQTAQDRNLGGKLAAGHPFLEAEVVYCVRHEYCQTPDDFLARR
TRLAFLDARAALRALPRVVELMAAELGWDSARRASMTSSAWSYLTTYLPPAAAAAAATAA
ARGGPGAGQPTAAPAS
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgccactcctcttcctcaagtcctacctccccgtggccgccgctgccggcgccttcgcc
gcagtcggcggtgccggttaccttcttagccagcagcaccagcagccgctatgggccagg
gggggtcctcagcccgacgaggcggaagcagtagagctgcttgagcggccccctccgcga
cccacacagctggagaggctgcgaggcagcactcgggaccgacccttcgatgtgctgatc
gtgggcgggggagctacggggtcgggatgtgctctggatgcggtgacaagggggcttcgt
acggcattggtggagcgtgacgactttggctccggaactagctccaaatccaccaaattg
gttcacgggggggtgcgctacttggagaaggctgtgttccaggccgacattcgccagctc
cgtctcgtgtacgaggcccttcacgagcgcgccacgatgctggccctggcgcccaacttg
gcagcccctagagccattctcacgccttgctacaagtggtgggaggtgccgtactactgg
gctgggctcaaggcatatgatttggtggcgggtcgcgccaacctcatttcctctcgctac
gtgccgccggctgaggccctagatatggtgcctactttggcaacctcgcattcggatggc
agcacactcaaaggggcggtgctgtactacgacggctactttgatgacgcccgtttcaat
gtggccctggcttgtactgcagccgctgcggggggtgtggtggccaactacgtggactgc
aaacagctgataaagaatcaagacggcaaggtggtgggggctgtcgtacaggaccgtctg
ggttcggagccgccctttgaggtgtacgcccgggtggttctcaacaccactggctgcttc
gtggatgaggtacggcacctttcccggcccgacgccctgcccatcatccagccctcctcc
ggcgcccacatcaccctgcccgccttctacggaggacatacacgaaacggaataatcatt
cctaaaacaaaggacggtcgcgtcgtgttcatgttgcccttcctggactcggtgattgcc
ggtacgacagactcgaaatgccacgtcacccgcaacccggtggctacccggcaggaggtg
gacttcatcctgggggagctgcaggactacctgggtatacaggtccgtccctccgacgtg
ctctccgtgtggtcaggcataaggcccctggcagccgacccgcgagccaaggacacacaa
aacacagtgcgcgatcacgttattgtggaggagggcgacggactgctcaccgccagcggc
ggcaagtggaccacctaccggctcatggcgcaggaggcggtggacgccgtggtggccaca
ggcaggatgccgaccaacgtgaaggcatgtcgtacaaccggaataccgttgctgggggct
gggcccgagtacagcaatacactggcggcgcagttggctcaggacttcgggcccctggcg
gcccatatcgccccggacgcggcggctgcttccctcacccccaccgcccccaccgcatcc
ttcaagacaacctccgccgccgccgccgccgccaccccgccccgggtggttattgatgcg
caaactgccgagcacctggcgcaggcgtacggcacccgtgctggtcgtgtgctgcagacc
gctcaggatcgcaatttgggcgggaaattggcggcgggacatccgtttttggaggctgag
gtggtgtattgtgtacgtcacgagtactgccagacgccggatgatttcctggcacgtcgt
acacgactggcgtttctggacgcccgagcggctctgagggccctaccccgggtggtggaa
ttgatggccgctgagttagggtgggactcggctcgtcgcgcctccatgacctcctccgcc
tggagctacctcactacctacctgccacctgcagcagcagctgcagcagcaacagcagca
gcaagggggggcccgggggctggacagcccacggcggcacccgccagctga

DBGET integrated database retrieval system