KEGG   Vibrio cholerae O395: VC0395_0979Help
Entry
VC0395_0979       CDS       T00520                                 

Gene name
amy1
Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vco  Vibrio cholerae O395
Pathway
vco00500  Starch and sucrose metabolism
vco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VC0395_0979 (amy1)
Enzymes [BR:vco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VC0395_0979 (amy1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase UxuA hDGE_amylase Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: ABQ18339
UniProt: A0A0H3ACH4
LinkDB All DBs
Position
1:954504..955904
Genome map
AA seq 466 aa AA seqDB search
MKSSYVVLCATFAAASFTSSVQAEAILHAFNWKYADVTANAAQIAAAGYKKVLISPALKS
SGNEWWARYQPQDLRVIDSPLGNKTDLQTLIKTLQDYGVEVYSDVVFNHMANESWKRSDL
NYPGSEVLASYTNQAYYYQQQKLFGDLSHNLFSQNDFHPEGCITDWGNPGHVQYWRLCGG
AGDRGLPDLDANAWVINQQRAYLQALKQMGIRGFRIDAVKHMSQYHIDQVFTPEIISGMH
VFGEVITSGGQGDGSYDAFLAPYLNNTTHAAYDFPLFASIRAAFSYQGSMSQLHDPQAYG
QALPNARAITFAITHDIPTNDGFRYQILNPQDEQLAYAYLLGKDGGTPLIYSDDLADHED
KDNGRWANVWNQPSMQHMLRFHNAMQGKPMTVMYSDSCLLLFKRGKEGVVGINKCGESKN
VTIDTYQHEFNWYQTYQDTLSDDRFSVSSRYHTLTIPARVARMWML
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatcgtatgttgttctttgtgccacattcgcggcagcaagttttactagcagc
gtacaagcagaagccattttgcatgcttttaactggaaatatgcagatgtcactgcgaat
gcagcacagatcgccgccgcaggttataaaaaagtgctgatctcaccagcattgaaatcc
agcggcaatgaatggtgggctcgttaccaacctcaagatctgcgagtcattgactcacct
cttggcaacaaaaccgacttacaaacactgatcaaaacgctgcaagattacggtgttgaa
gtatattcggatgtggtgtttaaccatatggcaaacgaaagttggaagcgtagtgatctc
aattatccgggcagcgaagtactagccagctacactaaccaagcttattactatcaacaa
cagaaactgttcggtgatttgtcgcacaatctcttctcacaaaatgatttccatcctgaa
ggttgtattactgattggggcaaccccggtcatgttcagtattggaggctatgcggtggc
gcaggtgatcgcggtctaccagacttggatgccaacgcttgggtcatcaatcaacagcga
gcctatttacaagcgcttaagcaaatgggtatcagaggatttcgaattgatgcggttaag
cacatgagtcaataccacattgaccaagtcttcacaccagagattatttcgggcatgcat
gtgtttggcgaagtgatcacaagtgggggtcaaggtgatggcagttatgatgccttccta
gctccttatctgaataacaccacacacgccgcatacgactttcctctatttgcctccatt
cgtgccgcattttcttatcaaggttcgatgagtcaattgcatgatccacaagcctatgga
caagcattaccaaacgcccgcgccatcacgtttgcgattacccatgatattcccactaat
gatggattccgttatcagatcctcaacccgcaagatgagcaactcgcttacgcttatcta
ctcgggaaagatggtggaacaccgctgatttatagtgatgatctggctgatcacgaagat
aaagataatggtcgttgggcgaatgtttggaatcaaccatcaatgcaacatatgctgcgc
ttccataacgcaatgcaaggtaaacctatgacggttatgtatagcgactcatgtttgctg
ctcttcaaacggggtaaggaaggtgtcgtaggtattaataaatgtggtgagtcaaaaaat
gtcaccatagatacttatcagcatgaatttaactggtatcagacctatcaagatacttta
agtgacgaccgttttagcgtgagcagtcgctaccatacgttaactatcccagcacgtgtt
gcgcgcatgtggatgctgtaa

DBGET integrated database retrieval system