KEGG   Vibrio cholerae O1 O395: VC0395_A0719Help
Entry
VC0395_A0719      CDS       T00520                                 

Definition
(GenBank) putative glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vco  Vibrio cholerae O1 O395
Pathway
vco00250  Alanine, aspartate and glutamate metabolism
vco00410  beta-Alanine metabolism
vco00430  Taurine and hypotaurine metabolism
vco00650  Butanoate metabolism
vco01100  Metabolic pathways
vco01110  Biosynthesis of secondary metabolites
vco01120  Microbial metabolism in diverse environments
vco02024  Quorum sensing
Module
vco_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VC0395_A0719
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VC0395_A0719
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VC0395_A0719
   00430 Taurine and hypotaurine metabolism
    VC0395_A0719
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VC0395_A0719
Enzymes [BR:vco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VC0395_A0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: ABQ20604
UniProt: A0A0H3AK76
LinkDB All DBs
Position
2:complement(744921..746567)
Genome map
AA seq 548 aa AA seqDB search
MVSEHKSAQVNFDSLLKIFTVPEGPDSTLTKIDEELSRNLNHFLRKHIVAEEKPLKEIEK
DFSNAHIPEQPQFVSDHTQYLLDTLVSHSVHTASPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMIHRLIYGETDHFYQQWMHSAEHSLGAFCSGGTIANITA
LWVARNNALKAEGDFPGVEKAGLFKAMRHYGHEGLAILVSERGHYSLKKAADVLGIGQEG
LVAVKTDAHNRICPHDLEQKITELKANKIKVFAVVGVAGTTETGNIDPLRTIAQICQREQ
IHFHIDAAWGGATLMSNRYRGLLDGVELADSVTIDAHKQLYIPMGAGMVLFKDPNAMRSI
EHHAQYILRQGSKDLGSHTLEGSRSGMAMLVYASMHIISRPGYQLLIDQSIEKARYFADL
IDAQTDFELVSQPELCLLTYRYLPEHVRMALEKSQGVQRAQLNELLNELTKFIQKKQRET
GKSFVSRTQLNPHQWDKLATIVFRVVLANPLTTKEILHNVLDEQREIAQQAPKLMRQIEH
LTQCILNQ
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagaacacaaatccgcgcaagtcaacttcgattctctgctcaagatcttcacc
gtaccggaaggtccagactcaacattaactaaaatcgatgaagagctttctcgcaattta
aaccacttcttgcgcaaacacattgtggcagaagaaaagccgctcaaagagattgagaaa
gatttttccaacgcgcacattcccgaacagcctcaattcgtttccgatcatacccaatat
ttactggatactctggtgtcacactcagtgcacaccgcatcgcccagttttattggccac
atgacatcggcactgccctacttcctgatgccgctgtcaaaaattatgatcgctctcaac
cagaatctggtcaaaattgaaacctcgaaggcattcacgccgctagagcgtcaagtgcta
ggcatgatccatcgcttgatttatggcgagacggatcacttctatcaacagtggatgcac
agtgctgagcactcactcggcgctttctgctcaggcggaaccatagccaacattacggca
ctttgggttgctcgtaataatgcgcttaaagcagaaggcgatttccccggcgttgaaaaa
gctgggctcttcaaagccatgcgccactacggtcatgaaggtttagccattttggtttcc
gaacgaggccactactcgttgaaaaaagcggccgatgtgctgggtataggccaagaaggc
ttggtcgcggtcaaaaccgatgcgcataaccgtatctgcccacacgatctagagcagaaa
atcaccgagttaaaagccaataagatcaaagtgtttgccgttgtcggagtcgccggcacc
acagaaaccggcaatattgacccactgcgcaccattgctcagatttgtcagcgtgaacag
atccacttccatatcgatgcggcttggggcggcgcgacgttaatgtcaaaccgttatcga
ggactgcttgatggtgtcgagttggccgattcagtgaccattgatgctcataagcagctc
tacatccctatgggtgcgggtatggtcttgtttaaagacccgaatgcgatgcgctcaatt
gagcatcatgcccagtacattttgcgtcaaggctctaaagatttgggtagccatacccta
gaaggatcacgctcaggcatggcgatgttggtttacgccagcatgcacatcattagccgc
ccaggctatcagctacttatcgatcaaagtattgaaaaagcgcgatattttgccgacctg
attgatgcgcaaactgactttgagttggtttcgcaaccggaactctgcttgttgacttat
cgctatctacccgagcatgtccgcatggcgctagaaaaatcgcaaggggtacagcgtgcg
cagttgaatgagctactgaacgaactcactaagtttattcagaagaaacaaagggaaacg
ggtaaatcctttgtgtcacgtacccaactcaatccacaccaatgggataaattggcaacc
atagtcttccgagtggtattggccaacccgctgacgaccaaagaaattttgcataacgtg
ctggatgaacaacgagaaatcgcgcaacaagcgccaaagttgatgcgtcaaatcgaacat
ctaacccaatgcattctgaaccaataa

DBGET integrated database retrieval system