KEGG   Vibrio cholerae O1 O395: VC0395_A0930Help
Entry
VC0395_A0930      CDS       T00520                                 

Definition
(GenBank) putative alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vco  Vibrio cholerae O1 O395
Pathway
vco00473  D-Alanine metabolism
vco01100  Metabolic pathways
vco01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VC0395_A0930
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    VC0395_A0930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vco01011]
    VC0395_A0930
Enzymes [BR:vco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VC0395_A0930
Peptidoglycan biosynthesis and degradation proteins [BR:vco01011]
 Precursor biosynthesis
  Racemase
   VC0395_A0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Lin0512_fam
Motif
Other DBs
NCBI-ProteinID: ABQ20402
UniProt: A0A0H3AIT7
LinkDB All DBs
Structure
PDB: 

Position
2:complement(952179..953465)
Genome map
AA seq 428 aa AA seqDB search
MEQPLLSRKKNVPSMITTGDIMHFKATLLSLSIAATLPSFSLSAAPLHIDTALPDAAQIQ
QSNSWLEISLGQFQSNIEQFKSHMNANTKICAIMKADAYGNGIRGLMPTIIAQGIPCVGV
ASNAEARAVRESGFKGELIRVRSASLSEMSSALDLNIEELIGTHQQALDLAELAKQSGKT
LKVHIALNDGGMGRNGIDMTTEAGKKEAVSIATQPSLSVVGIMTHFPNYNADEVRAKLAQ
FKESSTWLMQQANLKREEITLHVANSYTALNVPEAQLDMVRPGGVLFGDLPTNPEYPSIV
SFKTRVSSLHHLPKDSTVGYDSTFTTSRDSVLANLPVGYSDGYPRKMGNKAEVLINGQRA
KVVGVTSMNTTVVDVTEIKGVLPGQEVVLFGQQQKQSIAVSEMENNAELIFPELYTLWGT
SNPRFYVK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ttggagcagccgcttctcagtcgcaagaagaatgttccatcaatgataaccacaggagat
atcatgcattttaaagccacgctgctttctctctctatcgcggcgactttgccttctttc
tctctctctgctgcgccattacacatcgacaccgctttaccggatgccgctcaaattcag
caaagtaattcttggctggagattagcttaggccaattccaaagcaacattgaacaattc
aaatcacacatgaacgccaacaccaaaatttgcgccatcatgaaagccgacgcttacggt
aacggtattcgtggtttaatgccgaccattatcgcgcaaggcattccttgtgtgggggtg
gcaagtaatgcagaggcgcgtgcggtgcgtgaaagtggctttaaaggtgaactgatccgt
gtgcgctctgccagcctaagtgaaatgtcctcggcactcgatctcaatatcgaagagctg
attggtacccaccaacaagccctcgatctggcggagcttgccaaacaaagtggtaaaacg
ctcaaagttcacatcgcgctgaatgacggcggcatgggccgtaacggcattgatatgacc
acggaagccggcaagaaagaagccgtctctattgcgactcaaccttcgttgagtgtcgtt
ggcattatgacccacttcccgaattacaatgcggacgaagtgcgcgcaaaactggctcaa
ttcaaagagagctcaacttggctaatgcaacaagccaatttgaaacgtgaagagatcaca
ctgcatgttgcgaactcttacaccgcgctcaatgtgccagaagcacaactggacatggtt
cgtccaggtggcgtgttgtttggtgatttgccaaccaaccctgaatacccatcgattgtt
tctttcaaaacacgtgtgtcttcgctgcaccatttgccaaaggactcaactgtgggttat
gacagtacttttactaccagccgtgacagtgtgctggcgaacctgcctgtgggttattct
gatggttacccgcgcaaaatgggcaataaagccgaagtgctgatcaatggacaacgcgcc
aaagtcgtgggagtgacatcgatgaacaccactgtggttgatgtgaccgagattaagggc
gtgctccccggtcaagaagtggttctgtttggtcagcaacagaagcaaagcatcgcggtc
agtgagatggaaaacaacgctgagctgattttccctgagttgtatacgctgtggggaacc
agtaacccacgtttctacgtgaaataa

DBGET integrated database retrieval system