KEGG   Vibrio cholerae O1 O395: VC0395_A1840Help
Entry
VC0395_A1840      CDS       T00520                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
vco  Vibrio cholerae O1 O395
Pathway
vco00061  Fatty acid biosynthesis
vco00780  Biotin metabolism
vco01100  Metabolic pathways
vco01212  Fatty acid metabolism
Module
vco_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    VC0395_A1840 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    VC0395_A1840 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vco01004]
    VC0395_A1840 (fabZ)
Enzymes [BR:vco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     VC0395_A1840 (fabZ)
Lipid biosynthesis proteins [BR:vco01004]
 Fatty acid synthase
  Component type
   VC0395_A1840 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ABQ21189
UniProt: A5F629
LinkDB All DBs
Position
2:complement(1957328..1957789)
Genome map
AA seq 153 aa AA seqDB search
MMTLTTDKKTMNITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNVSVNEPQFTGHFPQ
LPVFPGVLILEAMAQATGLLAFKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMIEVEF
LKERRGIALFNGVAKVDGDVVCSAQLKCARREF
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgatgactttgactactgataagaaaacgatgaatatcactgaaattcaatcgcttctg
cctcaccgctatccatttttactgattgatcgcgtgaccgactatgaagaaggtaagtac
ctgattggtttgaaaaatgtttcagtgaatgagcctcagtttacgggtcactttccacaa
ctgccggttttccccggtgtattgattttagaagccatggctcaagccactggtctgttg
gcgttcaaaacctttggtgcgccaaaagagaatgaactgtactattttgccagcattgat
gaagctaagttccgtaagccagtgacaccgggcgatcaactgatgattgaagttgaattc
cttaaagagcgtcgtggtatcgcgctgtttaacggcgtggccaaagtcgatggtgatgtg
gtctgttctgctcaactgaaatgcgcacgtcgagagttttaa

DBGET integrated database retrieval system