KEGG   Vibrio cholerae O1 2012EL-2176: EN18_00080Help
Entry
EN18_00080        CDS       T03389                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq00550  Peptidoglycan biosynthesis
vcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EN18_00080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vcq01002]
    EN18_00080
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcq01011]
    EN18_00080
Enzymes [BR:vcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EN18_00080
Peptidases and inhibitors [BR:vcq01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   EN18_00080
Peptidoglycan biosynthesis and degradation proteins [BR:vcq01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   EN18_00080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AIT31232
UniProt: A0A0H6YPJ0
LinkDB All DBs
Position
2:15262..16398
Genome map
AA seq 378 aa AA seqDB search
MACMAFVPTLGFSALTVVPEPPQLAANGYVLIDFHTGKVLVEHNAHQKLNPASLTKLMTS
YVAGQEMKRGNIHADDQVRISNNAWAKKFPDSSKMFIEVGTYVNLMDLYRGLIVQSGNDA
SVAIAEHVAGSEGAFVSLMNSWAQQLGMNNSSFANPHGLDNPALYSTPYDIALLGRAIIR
DLPEIYPLYSELSFTYNGITQHNRNGLLRDRSMNVDGMKTGYTSGAGYSLASSATSGEMR
LISVVMGSKSVKSREAESKQLLSYGFRFYETVTPHQKDTVIQNQRLWYGDKNEVALGSAD
TVYLTLPRSDVKKLNAVIQLDQNLEAPIAKGDVVGSIFYYIDEEKVGEAKLVSQESVEQG
GIFKRLMDWFKLLFSGWF
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtatggcatttgtgccaacgttaggtttttccgctttgaccgtcgtacccgag
ccgccacaattggccgctaacggttatgttctaatcgatttccatacaggtaaagttctg
gtcgaacacaacgcacatcaaaaactcaatccggccagcttaaccaaactcatgacctcg
tacgtcgcaggacaagagatgaagcgtggcaatatccatgcggatgaccaagtgcggatc
agcaataacgcatgggccaagaaatttccagattcatcaaaaatgttcattgaagtgggc
acttacgtcaatttgatggatctttaccgcggcttgatcgtgcaatcagggaatgatgcc
agtgtggcgattgccgagcatgtcgctggatcggaaggggcgtttgtgagtctaatgaac
tcgtgggcgcagcaattggggatgaacaatagctcgtttgctaaccctcacgggctggat
aatcccgctctgtacagcacaccctatgacattgcgttactgggccgtgcgattattcgc
gatctaccggaaatctacccgctgtacagtgagctttcatttacttacaacggcatcact
caacacaaccgtaatggtctgctgcgcgatcgcagtatgaatgttgacggcatgaaaaca
ggttacaccagtggtgcgggatatagcttagccagctcggccaccagtggcgagatgcgc
ctcatttcagtggtgatggggtcaaaaagcgtgaagagtcgtgaggcagaaagtaaacaa
ctgctcagttatggtttccgtttttacgaaacggtgacaccacatcaaaaagacacggtg
atccagaatcagcgtctctggtatggagataaaaacgaagtggcgttgggcagtgctgat
actgtctacttaacactgccgcgcagcgacgtgaaaaaactcaatgctgtgatccaattg
gatcaaaacctcgaagcgccgatcgccaaaggtgatgtagtaggctcgattttctactac
attgatgaagaaaaggtcggcgaggccaaattggttagccaagaatctgtcgaacagggc
gggatctttaaacgtctgatggattggttcaagctgctcttctctggttggttttga

DBGET integrated database retrieval system