KEGG   Vibrio cholerae O1 2012EL-2176: EN18_03120Help
Entry
EN18_03120        CDS       T03389                                 

Definition
(GenBank) MFS transporter
Organism
vcq  Vibrio cholerae O1 2012EL-2176
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 Sugar_tr MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AIT31801
UniProt: A0A0H4JS56
LinkDB All DBs
Position
2:complement(620104..621252)
Genome map
AA seq 382 aa AA seqDB search
MAWPFLVVFLYQDYHATATEVGAMLATSALVGSLTGLYSGYLSDKFGRKWVMVSGTLIAT
FAYTGIGLSNQIWQFFIMIVLTGLMRPMIEAPGKAVIGDNLPDEKDRELALNVRYFLLNL
GGAIGPLIGITLALAHPQVLFIVTGIAYFLFGLWLLATLERKGRFQQPDRSLLPNFSATL
RVISKDNVFVKMMLANFLMMFVYGQVESSLPQVIVRSGIADAAQLVAGLVLVNTMTIILF
QFPTLKLLESVPLFTRTRLGMALMGLAQVGFMFTPEAFPLGWYLACFVLSMGEVIAFPTL
NVQIDRLAPAHLRGSYFGAAALYSLGFAIAPLAGGMMIEYLNAQWLYGLCFVLCLAMMGL
YYLAQREQEMGEKERLSRATEC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcttggccatttttagtcgtgtttctgtatcaagattatcacgcgacagcgacagaa
gtgggggccatgttggcaacatcggcactggtcggctcgttaacggggctctattcaggg
tatctttctgataagtttggccgcaaatgggtgatggtcagcggtaccctgatcgcgacg
tttgcttacactggcatcgggctttcaaatcaaatctggcaatttttcatcatgatcgtt
ttaactggattaatgcgccctatgattgaagcgcccggcaaagcggtgattggggataac
ttacccgatgaaaaagatcgtgaattggcgctcaatgtccgttattttctgcttaacctt
gggggagccattggcccattaataggaattacccttgcgcttgctcatccgcaagtgctg
tttatcgtcacgggcatagcgtattttctgtttggtttatggttgctcgccactttggag
cgtaaaggacgtttccaacaaccagatcgctcacttctccccaatttttctgccacttta
cgtgtgatcagtaaagacaatgtgttcgttaaaatgatgctggctaacttcctgatgatg
tttgtttatggtcaggttgagtcctcattgccgcaagtgattgttcgctctgggattgcg
gatgcggctcagttggtggccgggttagtattggtcaataccatgaccattattttattc
cagtttccgacattgaaactgttggaaagcgtgccgttgtttacacgtacgcgcttggga
atggctttgatggggcttgcgcaagtcggttttatgttcacccctgaagcttttccatta
ggttggtatttggcttgttttgtcttgagtatgggggaggtgatcgcatttccgacgcta
aatgtgcagattgaccgtttagcccccgctcatttacgaggctcttattttggtgcggca
gcgctttattcgttaggttttgcgattgctccactggctggaggtatgatgatcgaatat
ctcaacgcacagtggttatacgggctctgttttgttttgtgcttagccatgatgggtttg
tactacttggcgcagcgagagcaagaaatgggggagaaagagagattatctcgtgcaacg
gagtgttaa

DBGET integrated database retrieval system