KEGG   Vibrio cholerae O1 2012EL-2176: EN18_13330Help
Entry
EN18_13330        CDS       T03389                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Brite
Enzymes [BR:vcq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EN18_13330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIT30017
UniProt: A0A085QQH8
LinkDB All DBs
Position
1:1672428..1673012
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFENKSLEEIIKTS
TGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGAVAEAINAAFGSFADFKAKFTDSAINNFG
SSWTWLVKKADGTLAITNTSNAATPLTEEGVTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAQNLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattacccgctcttccttatgcgaaagacgcactggaaccacacatctca
gcagaaactctggatttccaccacggtaagcaccacaacacttatgtggtaaaactgaac
ggtctgatcccaggtactgagtttgaaaacaaatcactagaagagatcatcaagacctca
actggcggtattttcaacaacgctgcgcaggtttggaaccacactttctactggcactgc
ctatcaccaaacggtggtggcgagccaactggcgcagttgctgaagcaatcaatgcagca
ttcggttcttttgctgacttcaaagcaaaatttactgattcagccatcaacaacttcggt
tcatcttggacttggttggtgaaaaaagctgacggcactctggcgatcactaacacttca
aacgcagcaacaccgctgactgaagaaggtgtaacccctctgctgacggttgacctgtgg
gaacacgcgtactacatcgactaccgtaacgtacgtccagattacatgaatggtttctgg
gctctggttaactgggacttcgttgctcagaacctagcaaaataa

DBGET integrated database retrieval system