KEGG   Vibrio cholerae O1 2012EL-2176: EN18_13535Help
Entry
EN18_13535        CDS       T03389                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq00020  Citrate cycle (TCA cycle)
vcq00190  Oxidative phosphorylation
vcq00650  Butanoate metabolism
vcq01100  Metabolic pathways
vcq01110  Biosynthesis of secondary metabolites
vcq01120  Microbial metabolism in diverse environments
vcq01130  Biosynthesis of antibiotics
vcq01200  Carbon metabolism
Module
vcq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vcq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vcq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EN18_13535 (sdhB)
   00650 Butanoate metabolism
    EN18_13535 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EN18_13535 (sdhB)
Enzymes [BR:vcq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EN18_13535 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     EN18_13535 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4_4 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AIT30058
UniProt: A0A085SWA7
LinkDB All DBs
Position
1:complement(1718787..1719497)
Genome map
AA seq 236 aa AA seqDB search
MKLNFSLYRYNPDVDNKPYMKDYILEVEEGSDMMVLDALILLKEQDPSIAFRRSCREGVC
GSDGLNMNGKNGLACITPLSALKGDKIVIRPLPGLPVVRDLIVDMTQFYDNYAKVKPFLI
ADDALPPSRENLQSPEERAHLDGLYECIMCACCTTSCPSFWWNPDKFIGPAGLLAAYRWL
IDSRDTATDERLSNLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLINRSV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaacttctccttatatcgctataatccggatgtcgataacaaaccctacatg
aaagactacattcttgaggtagaggaagggtctgacatgatggtgttggatgctttgatt
ctgcttaaagagcaagatccaagtattgctttccgccgctcatgccgtgaaggggtttgt
ggctcggacggtctgaatatgaatggtaagaatggcttagcatgtatcacacctttgtct
gcgttaaaaggtgacaaaattgtgattcgtccgctgccaggattacctgtggttcgtgac
ttgattgtcgacatgactcagttttacgataactatgcgaaagttaagcctttcttgatt
gcagatgatgcattacccccttcaagagagaacttgcaatccccagaagaacgggcgcat
ttggatggtctgtacgagtgtattatgtgcgcttgctgtaccacttcctgcccttcattc
tggtggaatccggataaatttatcggacctgcaggtttgttggctgcttatcgttggttg
attgatagccgtgataccgcgacagatgaacgcttatcgaatcttgatgatgcgtttagc
gtttttcgttgccacggcatcatgaactgtgtcagtgtttgtccgaaaggattaaaccca
acgaaagccattggacatattaagtccatgttgatcaatcgttcagtttaa

DBGET integrated database retrieval system