KEGG   Vibrio cholerae O1 2012EL-2176: EN18_13540Help
Entry
EN18_13540        CDS       T03389                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq00020  Citrate cycle (TCA cycle)
vcq00190  Oxidative phosphorylation
vcq00650  Butanoate metabolism
vcq01100  Metabolic pathways
vcq01110  Biosynthesis of secondary metabolites
vcq01120  Microbial metabolism in diverse environments
vcq01130  Biosynthesis of antibiotics
vcq01200  Carbon metabolism
Module
vcq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vcq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vcq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EN18_13540 (sdhA)
   00650 Butanoate metabolism
    EN18_13540 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EN18_13540 (sdhA)
Enzymes [BR:vcq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EN18_13540 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     EN18_13540 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4 FAD_binding_3 OPA3
Motif
Other DBs
NCBI-ProteinID: AIT30059
UniProt: A0A085T8Y4
LinkDB All DBs
Position
1:complement(1719512..1721278)
Genome map
AA seq 588 aa AA seqDB search
MTIPVRSFDAVVIGAGGAGMRAALQISEQGLTCALLSKVFPTRSHTVSAQGGITVALGNS
HKDDWQWHMYDTVKGSDYIGDQNAIEYMCKNGPESVIELERMGLPFSRFENGTIYQRPFG
GQSKEFGGEQAARTAAAADRTGHALLHTLYQQNVKHKTTIFSEWYALDLVKNQDGAVLGC
TAICMETGEICYFKAKATVLATGGAGRIYASTTNAHINTGDGVGMALRAGVPMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMIEIREG
RGCDGPWGPHIKLKLDHLGRDVLESRLPGICELSRTFAHVDPVKEPIPVIPTCHYMMGGV
PTQVSGQAIKQDSHGKDVEVQGLFACGEIASVSVHGANRLGGNSLLDLVVFGRATGLHLG
ETLRAQAEARPATASDIEASLARTMRWENSKGGEDPVVIRKDLQRCMQNNFSVFREGKAM
AEGLEELKVIRERLKNAHLADKSTEFNTQRIECLELDNLMETAFSTAVAANYRTESRGAH
ARFDYPERDDENWLCHSIYNPETEQMSKREVNMTPVYRDPFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgactattccagttcgttcttttgacgccgtagtaatcggcgcaggtggtgcaggtatg
cgtgctgcactacaaatttctgagcaaggcctaacttgcgcactgctttcaaaagtgttt
ccaactcgttctcatacggtatccgctcaaggcggcattaccgtggctttgggtaactca
cataaagatgattggcagtggcatatgtatgacacggtaaaaggttccgactatatcggc
gaccaaaatgccatcgaatacatgtgtaaaaacggcccggaatccgtgattgaacttgag
cgcatggggctacctttttctcgttttgagaacggcacgatttatcagcgtccttttggc
ggtcagtcaaaagagttcggtggtgaacaagctgctcgtacggcagcagcagcagaccgt
actggtcatgctctactgcacacgctttaccaacaaaacgttaaacataaaaccaccatt
ttctcggaatggtatgcactggatctggtgaaaaaccaagatggtgctgtgctcggttgt
actgcaatctgcatggaaacaggcgaaatttgctacttcaaagccaaagcaacagtgctt
gcgacaggcggtgcaggtcgtatttacgcttcaaccaccaatgcacacattaacacgggc
gatggtgtcggtatggctttgcgtgctggcgtaccaatgcaagatatggaaatgtggcaa
ttccacccaacgggtatcgcgggtgctggcgttctggttacagaaggctgtcgtggcgaa
ggtggctatctgctgaataaagatggtgagcgtttcatggaacgttacgcgcctaacgct
aaagatctagcaggtcgcgacgtggttgcacgttcaatgatgatcgaaatccgtgaaggt
cgtggttgtgatggcccatggggtccacacatcaaactgaaactggatcatttaggtcgt
gatgtattggaatctcgcctaccgggtatctgtgaactatcacgtacctttgctcacgtg
gacccagtgaaagaacctattcctgttatcccaacctgtcactacatgatgggtggcgta
ccaacacaagtgtctggtcaagcgatcaaacaagacagccatggtaaagatgttgaagtc
caaggcttgtttgcttgtggtgaaatcgcttctgtatcggtacatggtgccaaccgttta
ggcggcaactcactgcttgatctggtggtatttggccgcgcaacgggtctacatcttggt
gaaactctgcgtgctcaagctgaggctcgccctgcgactgcatcggatatcgaagcttct
ctggctcgtactatgcgttgggaaaacagcaaaggtggcgaagatcctgtcgtgattcgt
aaagatctgcagcgctgcatgcaaaacaacttctcggtattccgtgaaggtaaggcgatg
gctgaggggctggaagagctcaaagtcatccgcgaacgtttgaaaaatgcccatctggcg
gacaaatcaaccgaatttaacactcaacgtattgagtgtttagagttggacaacctgatg
gaaacggcattttcgactgcagtagcggcaaactaccgtactgaaagccgtggtgcacat
gcgcgttttgactatccagagcgtgatgatgagaactggttgtgccactcaatctacaat
ccggaaacggaacagatgagtaagcgtgaggtcaatatgacaccggtttaccgtgacccg
ttcccgcctaaagtgcgtacatattaa

DBGET integrated database retrieval system