KEGG   Vibrio cholerae O1 2012EL-2176: EN18_14890Help
Entry
EN18_14890        CDS       T03389                                 

Definition
(GenBank) TorR family transcriptional regulator
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EN18_14890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vcq02022]
    EN18_14890
Two-component system [BR:vcq02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   EN18_14890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AIT30309
UniProt: A0A085QTK3
LinkDB All DBs
Position
1:1995103..1995819
Genome map
AA seq 238 aa AA seqDB search
MQTPQILIVEDEQVTRNTLKSIFEAEGYAVFEASNGEEMHQVLSDYPINLVIMDINLPGK
NGLLLARELREQADVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR
SMHAGTTQEEKRSVEKYVFNGWELDINSRSLVSPDGDSYKLPRSEFRALLHFCENPGKIQ
TRADLLKKMTGRELKPHDRTVDVTIRRIRKHFESVSGTPEIIATIHGEGYRFCGDLED
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccccgcagatccttatcgtcgaagacgagcaagtaactcgtaacactcttaag
agtatttttgaagcagagggatacgctgtttttgaggccagcaatggtgaagagatgcac
caagtgctgtccgattatccaattaacttggtgattatggacatcaacctgccaggaaaa
aatggcctgctgcttgcacgcgaactgcgtgaacaagcagatgtagcgctgatgttcctg
accggtcgcgacaatgaagtagataagattctgggcctagagatcggcgcagatgattac
atcaccaagcctttcaacccacgtgaactaaccattcgcgcacgtaacttgttgagccgc
tcaatgcatgcgggcaccacacaagaagaaaaacgtagcgttgaaaaatacgtgtttaat
ggttgggaactggatatcaacagccgttcactggtgagccctgatggtgatagctacaag
ctgccacgttctgagttccgtgctctgctgcacttctgtgaaaatccgggcaaaattcaa
actcgtgccgatctcttgaaaaagatgactggacgtgaactcaaaccacacgatcgtact
gttgatgtaacgatccgccgtatccgtaagcactttgaatctgtgtcaggtacgccagaa
atcattgccaccattcacggtgaaggctaccgcttctgtggtgatttagaagattaa

DBGET integrated database retrieval system