KEGG   Vibrio cholerae O395: VC395_1216Help
Entry
VC395_1216        CDS       T02099                                 

Definition
(GenBank) putative glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vcr  Vibrio cholerae O395
Pathway
vcr00250  Alanine, aspartate and glutamate metabolism
vcr00410  beta-Alanine metabolism
vcr00430  Taurine and hypotaurine metabolism
vcr00650  Butanoate metabolism
vcr01100  Metabolic pathways
vcr01110  Biosynthesis of secondary metabolites
vcr01120  Microbial metabolism in diverse environments
vcr02024  Quorum sensing
Module
vcr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vcr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    VC395_1216
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VC395_1216
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VC395_1216
   00430 Taurine and hypotaurine metabolism
    VC395_1216
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    VC395_1216
Enzymes [BR:vcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VC395_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: ACP09226
LinkDB All DBs
Position
I:complement(1276340..1277986)
Genome map
AA seq 548 aa AA seqDB search
MVSEHKSAQVNFDSLLKIFTVPEGPDSTLTKIDEELSRNLNHFLRKHIVAEEKPLKEIEK
DFSNAHIPEQPQFVSDHTQYLLDTLVSHSVHTASPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMIHRLIYGETDHFYQQWMHSAEHSLGAFCSGGTIANITA
LWVARNNALKAEGDFPGVEKAGLFKAMRHYGHEGLAILVSERGHYSLKKAADVLGIGQEG
LVAVKTDAHNRICPHDLEQKITELKANKIKVFAVVGVAGTTETGNIDPLRTIAQICQREQ
IHFHIDAAWGGATLMSNRYRGLLDGVELADSVTIDAHKQLYIPMGAGMVLFKDPNAMRSI
EHHAQYILRQGSKDLGSHTLEGSRSGMAMLVYASMHIISRPGYQLLIDQSIEKARYFADL
IDAQTDFELVSQPELCLLTYRYLPEHVRMALEKSQGVQRAQLNELLNELTKFIQKKQRET
GKSFVSRTQLNPHQWDKLATIVFRVVLANPLTTKEILHNVLDEQREIAQQAPKLMRQIEH
LTQCILNQ
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagaacacaaatccgcgcaagtcaacttcgattctctgctcaagatcttcacc
gtaccggaaggtccagactcaacattaactaaaatcgatgaagagctttctcgcaattta
aaccacttcttgcgcaaacacattgtggcagaagaaaagccgctcaaagagattgagaaa
gatttttccaacgcgcacattcccgaacagcctcaattcgtttccgatcatacccaatat
ttactggatactctggtgtcacactcagtgcacaccgcatcgcccagttttattggccac
atgacatcggcactgccctacttcctgatgccgctgtcaaaaattatgatcgctctcaac
cagaatctggtcaaaattgaaacctcgaaggcattcacgccgctagagcgtcaagtgcta
ggcatgatccatcgcttgatttatggcgagacggatcacttctatcaacagtggatgcac
agtgctgagcactcactcggcgctttctgctcaggcggaaccatagccaacattacggca
ctttgggttgctcgtaataatgcgcttaaagcagaaggcgatttccccggcgttgaaaaa
gctgggctcttcaaagccatgcgccactacggtcatgaaggtttagccattttggtttcc
gaacgaggccactactcgttgaaaaaagcggccgatgtgctgggtataggccaagaaggc
ttggtcgcggtcaaaaccgatgcgcataaccgtatctgcccacacgatctagagcagaaa
atcaccgagttaaaagccaataagatcaaagtgtttgccgttgtcggagtcgccggcacc
acagaaaccggcaatattgacccactgcgcaccattgctcagatttgtcagcgtgaacag
atccacttccatatcgatgcggcttggggcggcgcgacgttaatgtcaaaccgttatcga
ggactgcttgatggtgtcgagttggccgattcagtgaccattgatgctcataagcagctc
tacatccctatgggtgcgggtatggtcttgtttaaagacccgaatgcgatgcgctcaatt
gagcatcatgcccagtacattttgcgtcaaggctctaaagatttgggtagccatacccta
gaaggatcacgctcaggcatggcgatgttggtttacgccagcatgcacatcattagccgc
ccaggctatcagctacttatcgatcaaagtattgaaaaagcgcgatattttgccgacctg
attgatgcgcaaactgactttgagttggtttcgcaaccggaactctgcttgttgacttat
cgctatctacccgagcatgtccgcatggcgctagaaaaatcgcaaggggtacagcgtgcg
cagttgaatgagctactgaacgaactcactaagtttattcagaagaaacaaagggaaacg
ggtaaatcctttgtgtcacgtacccaactcaatccacaccaatgggataaattggcaacc
atagtcttccgagtggtattggccaacccgctgacgaccaaagaaattttgcataacgtg
ctggatgaacaacgagaaatcgcgcaacaagcgccaaagttgatgcgtcaaatcgaacat
ctaacccaatgcattctgaaccaataa

DBGET integrated database retrieval system