KEGG   Vibrio cholerae O1 O395: VC395_2759Help
Entry
VC395_2759        CDS       T02099                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vcr  Vibrio cholerae O1 O395
Pathway
vcr00620  Pyruvate metabolism
vcr00680  Methane metabolism
vcr01100  Metabolic pathways
vcr01120  Microbial metabolism in diverse environments
vcr01200  Carbon metabolism
Module
vcr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VC395_2759 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    VC395_2759 (ppc)
Enzymes [BR:vcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VC395_2759 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACP10744
LinkDB All DBs
Position
I:2903776..2906439
Genome map
AA seq 887 aa AA seqDB search
MDVIFFQGRMTMNEKYAALKSNVSMLGRLLGQTIQAADGDVILAKVETIRKLSKSARAGN
QADRELLIEEIKNLPNHQLTPVARAFNQFLNLTNIAEQYHTISRHCESHVNELDAIGSLF
AKLAQKSVSKFDTAQAIRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSPK
ERHKTERRLEQLIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWHAVPEFLRELDEQVK
SYLGEGLPIDARPVHFSSWMGGDRDGNPFVTHTITREVLLLSRWKAADLYLTDINELVSE
LSMTKCNEAVRALAGEEHEPYRAILKPIRSLLQETIEILDAKLNGQKLAVKAPLQTADQL
WEPLYACYQSLHECGMGVIADGSLLDTLRRIKAFGVHLVRLDVRQESSRHAEVISELTRH
LGIGDYNQWSEQDKIAFLTTELNSKRPLLPRDWQPSPQVKEVLDTCKIIAAQSKDAFGAY
VISMARTASDVLAVHLLLQEAGCPYRMDVCPLFETLDDLNNAESVIRQLMNIDLYRGFIQ
NHQMVMIGYSDSAKDAGVMAAGWAQYRAMEALVKVGEEAGIELTLFHGRGGTIGRGGAPA
HAALLSQPPKSLKGGLRVTEQGEMIRFKLGLPEVAVNSFNMYASAILEANLLPPPEPKNE
WRALMDILSEISCNAYRKVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPTGGVESL
RAIPWIFSWSQNRLILPAWLGAGEAIQIAINEGHQALLEEMCREWPFFSTRLGMLEMVYT
KCSVSIARHYDERLVEPTLRPLGEKLRAQLQQDIKVVLNVENNENLMQSDPWGQESIRLR
NIYIEPLNMLQAELLYRTRQSELPAPELEEALMVTIAGIAAGMRNTG
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
ttggatgtaattttttttcaaggcaggatgacaatgaacgaaaaatacgctgcgctcaaa
agtaacgtaagcatgttaggacgactactcggccagacaattcaagccgccgatggtgac
gttattttagcgaaagtggaaaccatccgaaaactttccaaatctgcccgagcgggcaac
caagcagaccgcgagctgctgatcgaagagatcaaaaatcttcctaaccaccaactgact
cccgtggctcgcgcctttaaccaattcctgaacctgaccaatattgccgagcagtatcac
accatctcacgccactgtgaaagccacgtgaatgagttggatgcgattggtagcctgttt
gctaaactggcgcagaagtcggtcagtaaattcgatacggcgcaagccattcgcgatctc
aacattgagctggtattgaccgctcacccgactgagatcactcgtcgcactatgatcaac
aagctagtcaaaatcaacgagtgtctgtccaaacttgagctcagcgacctctctccgaaa
gagcgccataaaaccgagcgccgccttgagcaattaattgcccaaagctggcattcggat
gtgattcgtcagcagcgtccaacgccattagatgaagccaaatgggggttcgcagtcgta
gaaaactcattgtggcacgccgtccctgagtttttgcgtgagctggatgaacaggtgaaa
tcttacctaggtgaaggtttaccgattgatgcacgccctgtgcatttctcatcttggatg
ggtggagatcgcgatggtaacccctttgtgacccacactatcactcgcgaagtgctgtta
ctgtcacgctggaaagcagccgatttgtatctcaccgatatcaatgaactggtcagcgaa
ctttcgatgaccaagtgtaatgaagccgtacgcgctttagccggcgaagagcacgaacct
tatcgcgccatcctcaagccaatacgaagcttgctgcaagagacgattgaaattcttgat
gcaaaactcaacggccaaaaactggcagtaaaagctcctttgcaaaccgcagatcagttg
tgggaaccgctctacgcgtgttaccaatcactgcatgagtgtggcatgggcgtaatcgca
gatggttccttgctcgataccctgcgccgcattaaagcctttggcgtgcatctggttcgc
ctcgatgttcgtcaagagagctcacgccatgcagaagtgatctcggaactgactcgtcat
ctcggcatcggcgattacaatcagtggagcgagcaagataaaatcgcgttcctgaccaca
gagctgaactcgaaacgcccactgctaccacgcgattggcaaccgtcgcctcaagtcaaa
gaggtgttggatacctgtaagatcatcgctgcgcagtccaaagatgcctttggcgcttat
gtcatttcgatggcgcgtactgcatcggatgtcctcgccgtgcacctgctgctgcaagag
gcaggatgtccttatcgtatggatgtttgcccgctgtttgaaaccttagatgacttgaac
aatgcagaatcggtgatccgtcaactgatgaacatcgatctgtatcgcggctttattcag
aaccaccaaatggtgatgattggttattccgattccgccaaagatgcgggggtgatggcg
gcaggctgggcgcaataccgagcgatggaagcgctagtgaaagttggcgaagaagcgggg
atcgaactcactctattccatggtcgcggcggcacaattggtcgcggcggtgctcctgca
cacgcggcactgctttctcagccaccaaagagtttgaagggcggtctgcgtgtaaccgaa
caaggcgaaatgatccgctttaaactgggtctacctgaagtggcggtcaacagctttaac
atgtacgccagcgctattttggaagccaacttgctccccccaccagagcctaaaaatgag
tggcgtgcgctgatggatattctgtcggaaatttcatgtaatgcttaccgaaaagtcgtg
cgtggtgaaccagactttgttccttacttccgtcaagccacaccagaattagaactcggc
aagctgccattgggttccagacccgccaaacgtaatcctactggtggagtcgagagcctg
cgagccattccatggatcttctcatggagccagaatcgtctcattcttcctgcttggtta
ggtgcgggtgaagcgatccaaattgccattaatgaaggacaccaagcgctacttgaagag
atgtgccgcgaatggccattcttctcaactcgccttggcatgctggaaatggtgtacacc
aaatgcagtgtaagcatcgcgcgtcattatgatgagcgacttgttgaaccgactttgcgt
ccattgggtgagaaattgcgtgctcaattacagcaagacattaaagttgttctgaacgtt
gagaataacgagaacctgatgcaaagcgatccttggggacaagagtcgattcgtctgcgt
aacatctatattgaaccactcaatatgctgcaagcagaactgctgtatcgtacccgtcaa
tcagaacttcctgctccagaactggaagaagccttgatggtgaccattgcgggaattgcg
gcgggaatgcgcaatactggttaa

DBGET integrated database retrieval system