KEGG   Vibrio cholerae O1 El Tor MS6: MS6_0420Help
Entry
MS6_0420          CDS       T03666                                 

Definition
(GenBank) multimodular transpeptidase-transglycosylase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
vcs  Vibrio cholerae O1 El Tor MS6
Pathway
vcs00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vcs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MS6_0420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:vcs01003]
    MS6_0420
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcs01011]
    MS6_0420
Enzymes [BR:vcs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     MS6_0420
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MS6_0420
Glycosyltransferases [BR:vcs01003]
 Polysaccharide
  Bacterial polysaccharide
   MS6_0420
Peptidoglycan biosynthesis and degradation proteins [BR:vcs01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   MS6_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: BAP02075
LinkDB All DBs
Position
1:478418..480751
Genome map
AA seq 777 aa AA seqDB search
MTRKSSNRSRGRKARSGKSASSSKLQIWLGRIWSIGWKLALTLAAVLVFIGIYLDSMIKQ
RFEGQLFDLPTVVYARILTLEPGNGLSLQELRNELDVLNYRKVAQPRFPGEYASSSSRIE
LIRRPFEFADGPEPDRRVMLTFDGSGLNKIESLEQKRELGYLRLEPKLMGMLEKDSPEQR
LFLRRDQFPEVLVDALLVTEDRDFYQHDGVSPLAIGRAMVVNLKAGRTVQGGSTLTQQLA
KNIFLSSDRTLWRKLREAYMALIIDYRYSKDRILEAYLNEVYLGQSGADAIHGFGLASRL
YFGQPLQELRIDQLALLVGMVKGPSYYNPMRYPERARERRDLVLKLMMEHDILTAQEYQQ
AVTRPLDVQKTPQIASRQPAYFQQVSIELKEKLGDKFKADSGLRVFTSLDPVSQSKLEQA
IHDQIPQLAKTAGKDLEAAAIAVDRHSGEIRAMVGGKRTGYDGFNRVLNASRQIGSLVKP
AVYLTALAHPDQYNLATTLEDKPLTLKGSEGSAWTPRNYDRQYRGEVPLYMALAQSLNVP
TVALGMKLGIDQVSATLGKLGVNRDEIRPVPSMLLGSFSLTPYQVAQMYQTLTNSGKKAP
LSALRSVLDLEGNVLYESLPRVSQAVDQQAAWLTTYAMKQGVQEGTGRYLNAQFSSAALA
GKTGTTNDNRDSWFVGVDGREVTTIWLGRDDNQPTKLTGASGALRVYAQYLKYRIPEKLQ
LPWPEGITTFGFAKQTQGGLKLDCDNAFKLPIWDNQQQLKQQCENRPTEWIKKLFEW
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaaaaagtagtaacagatcgcgtggccgtaaagcgcgcagtggtaaaagtgcc
tcttcctccaagctgcaaatctggctgggaaggatttggagtatcggctggaaattagcg
ctgacgctggccgcagtgctggtttttattggtatctatctcgattcgatgatcaaacag
cgctttgaaggtcagctgtttgatctaccgaccgtggtctatgcacgtattttaacgctt
gagcccggcaacggcctcagtttgcaagaactgcgcaatgagctcgatgtcctcaattac
cgcaaagtggcacagccccgtttccccggtgaatacgcgtcttcttccagtcgaattgag
ctgatccgccgtccgtttgaattcgcggatggcccagagccggatcgccgagtgatgctc
acctttgatggcagtggtttgaacaaaattgaatcattagagcaaaaacgcgagctaggc
tacctgcgtttagagccaaaactgatgggcatgctggaaaaagattcgccggagcagcga
ctctttttacgtcgcgatcaattccccgaagtgttggttgatgcactcttagtcaccgaa
gatcgtgatttttatcagcacgatggcgtatcaccacttgcgattgggcgcgctatggtg
gtcaacctcaaagctgggcgcacggtacaagggggcagtaccttgacccagcagctggct
aaaaacatcttcctttctagcgatcgcaccttgtggcgtaagttgcgcgaagcctatatg
gcgctgatcatcgattatcgttacagcaaagatcgcattcttgaagcctatcttaacgaa
gtttatttagggcaaagtggcgcagatgcgatccacggttttggtctggcttcacggctc
tattttggtcagccgctgcaagagctacggattgatcaattggcattgttggttggcatg
gttaaagggccttcttattacaacccgatgcgttatcccgagcgcgctcgcgagcggcgc
gatctggtgctgaaactgatgatggagcacgatattctgacggcgcaagagtaccagcaa
gcggtaactcgtccgttggatgtgcagaaaaccccgcaaatcgctagccgtcagccagcg
tatttccagcaagtttctattgagctgaaagaaaaactgggcgacaaatttaaagcggat
tcaggattacgggtgtttacctcgctcgatccggtttcgcagtccaaactcgagcaagcg
atccacgatcagatcccgcaattagcgaaaaccgcaggcaaagatctcgaagccgctgcg
atcgctgtggatcgtcatagtggcgaaattcgtgccatggtcggcggtaagcgaaccggt
tacgatggttttaaccgcgtgctcaatgccagtcgacaaattggttcactggtgaaacca
gcggtgtatctcacggcgttagcgcatcccgatcagtacaatctagccactacactggaa
gataaaccactcaccttaaaaggcagtgaaggcagcgcgtggacaccacgaaactacgat
cgtcaatatcgtggagaagtgccattgtatatggcgctcgctcaatcgcttaatgtgccg
accgtggctttggggatgaagcttgggattgatcaagtctcagcaaccttgggtaagctc
ggcgtgaatcgcgacgaaattcgccctgtcccttcgatgttgctcggttcattctcactc
acgccatatcaagtggcgcagatgtaccaaacgttgaccaactccggcaaaaaagcgcca
ctctcagcgctgcgttcggtgctcgatctggaaggtaatgtgttgtatgaatctctgccg
agagtgtcacaagcggtagatcagcaagccgcttggctgacgacttacgccatgaaacaa
ggggtgcaagaggggacgggacgttacttgaatgcgcagttcagcagtgcagcactggcg
gggaaaactgggaccactaacgataaccgtgacagttggtttgtgggggtcgatggccgt
gaagtgaccaccatttggcttggccgcgatgataaccagccaacgaagctcactggcgcg
agtggggcattacgtgtttatgcgcagtatttgaaatatcgcattccagagaaattacag
ttaccttggccagaaggcataacgacctttggctttgccaagcagacgcaaggtggattg
aaactcgactgtgataatgcgtttaaactgcctatttgggacaatcaacagcagttaaaa
cagcagtgtgaaaaccgtccgaccgagtggatcaaaaagctgtttgagtggtaa

DBGET integrated database retrieval system