KEGG   Vibrio cholerae O1 El Tor MS6: MS6_0743Help
Entry
MS6_0743          CDS       T03666                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
vcs  Vibrio cholerae O1 El Tor MS6
Pathway
vcs00550  Peptidoglycan biosynthesis
vcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MS6_0743
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:vcs01002]
    MS6_0743
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcs01011]
    MS6_0743
Enzymes [BR:vcs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MS6_0743
Peptidases [BR:vcs01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   MS6_0743
Peptidoglycan biosynthesis and degradation proteins [BR:vcs01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   MS6_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: BAP02398
LinkDB All DBs
Structure
PDB: 

Position
1:complement(860361..861536)
Genome map
AA seq 391 aa AA seqDB search
MKKSILKSVLASSITLSITLSSTAFASPIVTPDAPQIAAKGYVLMDYHSGKVLAEKEMDT
KLSPASLTKMMTSYVIGQEVKRGNISLNDDVVISKNAWAKNFPDSSKMFVEVGTTVKVSD
LNRGIIIQSGNDACVAMAEHVAGTEDAFVDLMNAWASSLGMKNSHFTNSHGLDDPNLYST
PYDLALLGQALIRDVPEEYAIYSEQKFTYNGITQYNRNGLLWDKSMNVDGIKTGHTSGAG
YNLVSSATEGNMRLVAVVMGTDNENARKAESKKLLSYGFRFFETVAPHKAGETFVNETIW
MGDKDTIALGVDKDTYVTLPRGQAKDLTASFVLEKQLKAPLKKGDVVGTLYYQLAGNDIA
QYPLLALEDVQEGSLFSRLWDYLVLLFKSWF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcaatcctcaaatctgtgttagcgtcttctattacgctttctatcacgcta
agcagcactgctttcgcctctcctatcgtgacaccagacgcaccacaaattgccgctaaa
ggctatgtactgatggattaccattcaggaaaagtgttggctgaaaaagagatggatacc
aaactctctcctgccagcctaaccaagatgatgaccagttacgtgatcggtcaagaagta
aagcgtggcaatatctcgctgaatgacgatgtagtgatcagcaaaaatgcttgggcgaaa
aacttccctgattcttcgaaaatgttcgttgaagtcggtaccactgttaaggtcagcgat
ctcaaccgcggcatcatcatccaatcgggtaatgatgcgtgtgtagcgatggcagagcac
gtcgcagggacggaagatgcgtttgttgacctgatgaacgcttgggcaagctcacttggg
atgaagaattcgcacttcactaactctcacggtttggacgatcctaatctttactctacg
ccatacgatctggctctacttggccaagctctgatccgtgatgtgcctgaagagtacgcg
atctactccgagcaaaaattcacctacaacggcatcactcaatacaaccgtaacggtttg
ctttgggataaaagcatgaatgtggacggcattaaaaccggtcatacgagtggtgctggc
tataacctcgtgagctctgctacagaaggcaacatgcgcttggttgcggtggtgatgggt
actgacaacgaaaacgcgcgtaaagcggaaagtaagaagctactgagctacggtttccgc
ttctttgaaaccgtggcaccacacaaagcgggtgaaactttcgtgaatgaaaccatctgg
atgggcgataaagacacgattgcactcggtgttgataaagatacttacgtaactttgcca
cgcggacaggccaaagatctcaccgccagctttgtacttgaaaaacaattgaaagcaccg
ctgaagaagggcgatgtcgtcggcacactttactatcaattagctggtaacgatattgct
caatacccattgctcgcactggaagatgtgcaagaaggcagcctatttagccgcctatgg
gattacttggttctgctgttcaaaagctggttttaa

DBGET integrated database retrieval system