KEGG   Vibrio cholerae MS6: MS6_1366Help
Entry
MS6_1366          CDS       T03666                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vcs  Vibrio cholerae MS6
Brite
Enzymes [BR:vcs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MS6_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu FlgD_ig
Motif
Other DBs
NCBI-ProteinID: BAP03021
LinkDB All DBs
Position
1:complement(1552337..1552852)
Genome map
AA seq 171 aa AA seqDB search
MNQFTLFAVAAFFSSSVLAQEMTVVMTDLSSGQSVGTVTLTDSEYGTVFTPQLTGLPAGL
HGFHVHANGSCETSSKDGKTVLGGAAGGHYDPQNTGKHGYPWTNDNHLGDLPALYVDAQG
QANQPVLASRFKMAEVKGKALMVHAGGDNHSDHPMPLGGGGARIVCGVIGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatttactttgtttgcggtcgccgcgtttttttcttcttcggttttggcgcaa
gaaatgaccgtagtgatgacggatttgagctctggccaatccgtgggcaccgttacctta
actgatagcgagtatggtacggtctttactccgcagttaactggcttgccagccggtttg
cacggttttcatgtacacgcgaatggctcatgtgaaacctcgtccaaagatggcaaaacc
gtattaggtggcgctgcgggtgggcattatgatccgcaaaacacgggaaaacacggctat
ccgtggaccaacgacaatcacttgggtgatctcccagctttgtacgtggatgcgcaaggc
caagcaaatcaacccgttttggcatcccgcttcaaaatggcagaggtaaaaggtaaagct
ttgatggtccacgcgggcggggataaccattccgaccatccaatgcctttgggtggcggt
ggtgcgcgcatcgtatgtggtgtgattggtttataa

DBGET integrated database retrieval system