KEGG   Vibrio cholerae O1 El Tor MS6: MS6_1798
Entry
MS6_1798          CDS       T03666                                 

Definition
(GenBank) Na+/H+ antiporter
  KO
K03315  Na+:H+ antiporter, NhaC family
Organism
vcs  Vibrio cholerae O1 El Tor MS6
Brite
KEGG Orthology (KO) [BR:vcs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vcs02000]
    MS6_1798
Transporters [BR:vcs02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   MS6_1798
SSDB
Motif
Pfam: Na_H_antiporter DcuC
Other DBs
NCBI-ProteinID: BAP03453
LinkDB
Position
1:2053269..2054714
AA seq 481 aa
MLQAQQRLPSLTQVIVSLGLFLLLAFSFTAKLDLPIQLALYIGWFVIMTLGIRLGHKYKD
LENAALNGISNGLGAVLILLAVGALVGTWISGGIVPTIIYYGLKAIHPSIFLLATMVICS
LTALATGTSWGAAGTAGIAMMGIGQGLGIPAPITAGAVLSGCYFGDKMSPLSDSVILASS
MSNVEVMEHIKGMLPIALISYVITGILFTLFGFHYAGNVDMSQVETVITAMEQQFYITPY
SFVPVLIVLGLLAMRMPSFPVISFGSLLGIVWAVMIQDVDFLQAFNTAWAPYNIESGVSF
IDAILNRGGMSSMLGSVAVIVFGLGFGGLLDRVGVLETIAKLFERRVTSPGSLATSTIGT
AFMGNVFGSAMYVSLILTPKICAKNYDRLGYQRKNLSRNAEFGGTLTSGMVPWSDNGIYM
ASILGVATLSYAPFMWLSFVCILVTIITSYCGWFVDKCEPTQAMNEQEVTAEEIQKAPAS
A
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgttacaagcccaacaacgcctgccaagtttgactcaagtaatcgtctcgcttggccta
tttttgctgttagcgttttcatttaccgcaaaactggatttaccgatccaactggctctg
tatattggctggttcgtgatcatgacgttaggtattcgcctaggacataaatacaaagac
ttagaaaatgctgccctaaatggcatttcaaatggtttaggcgcagtgctgatcttattg
gcggtcggtgctcttgtcggaacgtggatttccggcggtattgtgccaaccatcatctat
tacggtctaaaagcaattcacccttctatctttttattagccactatggtgatttgttca
ttgactgctctggcaacgggaacctcttggggtgcggcaggtaccgccggtattgccatg
atggggattggacaaggccttggtattccagcgcctatcactgcaggtgctgtgctgtca
ggctgttacttcggcgataagatgtctcccctgtctgactccgtgatcttagcctcttcg
atgtctaacgttgaagtgatggaacacattaaaggcatgttaccgattgctctgatcagc
tatgtgatcacgggtattctgtttacgctgtttggcttccactacgctggcaacgtcgat
atgtcacaagtagagacggtcattaccgcgatggaacagcagttttacatcacgccttat
tctttcgtgcctgtgttgattgtgcttggtttgttggcaatgcgtatgccttctttccca
gtgatcagctttggttcattgctcggtatcgtttgggctgtgatgatccaagatgtcgat
ttccttcaagcgttcaacaccgcatgggcaccttacaatattgaatctggcgtaagcttt
attgatgcaattcttaaccgtggcggtatgtcatccatgctcggatcggttgcggttatc
gtcttcggtcttggttttggtggtctgctcgatagagtcggcgtgctagaaaccatcgcc
aaactgttcgagcgccgagtcactagcccaggttcgctagcgaccagcactatcggtacc
gcctttatggggaacgtttttggttctgcgatgtatgtatcactgatcctgaccccaaaa
atctgtgccaagaactacgatcgtttaggctatcaacgtaagaacttgtctcgtaacgca
gaattcggcggtacactgacctctggcatggtgccttggagtgataacggcatctatatg
gcgagcattttgggtgtggcgactctctcttatgcaccgtttatgtggttaagtttcgtg
tgtatcctcgtcactatcatcacatcttactgtggttggtttgtcgataaatgtgaaccc
acacaggccatgaatgaacaagaagtgacggcagaggaaatccagaaagcaccggcttct
gcataa

DBGET integrated database retrieval system