KEGG   Vibrio cholerae O1 El Tor MS6: MS6_1995Help
Entry
MS6_1995          CDS       T03666                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
vcs  Vibrio cholerae O1 El Tor MS6
Pathway
vcs00061  Fatty acid biosynthesis
vcs00780  Biotin metabolism
vcs01100  Metabolic pathways
vcs01212  Fatty acid metabolism
Module
vcs_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vcs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MS6_1995
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MS6_1995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vcs01004]
    MS6_1995
Enzymes [BR:vcs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     MS6_1995
Lipid biosynthesis proteins [BR:vcs01004]
 Fatty acid synthase
  Component type
   MS6_1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: BAP03650
LinkDB All DBs
Position
1:complement(2264170..2264601)
Genome map
AA seq 143 aa AA seqDB search
MNITEIQSLLPHRYPFLLIDRVTDYEEGKYLIGLKNVSVNEPQFTGHFPQLPVFPGVLIL
EAMAQATGLLAFKTFGAPKENELYYFASIDEAKFRKPVTPGDQLMIEVEFLKERRGIALF
NGVAKVDGDVVCSAQLKCARREF
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcactgaaattcaatcgcttctgcctcaccgctatccatttttactgattgat
cgcgtgaccgactatgaagaaggtaagtacctgattggtttgaaaaatgtttcagtgaat
gagcctcagtttacgggtcactttccacaactgccggttttccccggtgtattgatttta
gaagccatggctcaagccactggtctgttggcgttcaaaacctttggtgcgccaaaagag
aatgaactgtactattttgccagcattgatgaagctaagttccgtaagccagtgacaccg
ggcgatcaactgatgattgaagttgaattccttaaagagcgtcgtggtatcgcgctgttt
aacggcgtggccaaagtcgatggtgatgtggtctgttctgctcaactgaaatgcgcacgt
cgagagttttaa

DBGET integrated database retrieval system