KEGG   Vibrio cholerae O1 El Tor MS6: MS6_2093Help
Entry
MS6_2093          CDS       T03666                                 

Definition
(GenBank) uracil-DNA glycosylase, family 1
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
vcs  Vibrio cholerae O1 El Tor MS6
Pathway
vcs03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:vcs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    MS6_2093
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vcs03400]
    MS6_2093
Enzymes [BR:vcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     MS6_2093
DNA repair and recombination proteins [BR:vcs03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     MS6_2093
 Prokaryotic type
     MS6_2093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG Tox-HDC
Motif
Other DBs
NCBI-ProteinID: BAP03748
LinkDB All DBs
Structure
PDB: 

Position
1:complement(2375073..2375753)
Genome map
AA seq 226 aa AA seqDB search
MSESLTWHDVIGNEKQQAYFQQTLQFVESQRQAGKVIYPPAKDVFNAFRFTEFGDVKVVI
LGQDPYHGPNQAHGLCFSVLPGVKTPPSLVNIYKELAQDIPGFQIPPHGYLQSWAQQGVL
LLNTVLTVEQGMAHSHANTGWETFTDRVIDALNQHRNGLIFLLWGSHAQKKGQMIDRQRH
HVLMAPHPSPLSAHRGFLGCRHFSKTNQLLQAQGIAPINWQPELES
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatcactgacgtggcatgatgtcattggtaatgaaaagcagcaggcttacttt
caacaaactctgcaatttgtcgaaagccagcgtcaagccggaaaagttatctatcctccc
gctaaagatgtgtttaacgcctttcgctttaccgagtttggtgacgtgaaagtggtgatc
ttggggcaagatccttatcacggccctaatcaggcgcatggtttgtgtttctctgtgcta
ccgggtgtcaaaacaccgccctcgttagtcaatatttataaagagttagcgcaagatatc
cctggatttcaaatcccacctcatggctacctacaaagttgggcacagcagggcgttttg
ctactcaacaccgtattgactgttgaacaaggtatggcccattctcatgcgaataccggc
tgggaaaccttcacggatcgtgtgattgacgccttgaatcaacaccgaaatgggttgatc
ttcctattgtggggatcgcacgcgcagaaaaagggccagatgatcgatcgccagcgccat
catgtcttgatggctccgcacccttcaccgctttcggcgcacaggggctttttaggatgt
cggcatttctctaaaaccaatcaattgctgcaagcgcaaggtatcgctcccattaactgg
cagcccgagctcgaatcttaa

DBGET integrated database retrieval system