KEGG   Vibrio cholerae MS6: MS6_2143Help
Entry
MS6_2143          CDS       T03666                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vcs  Vibrio cholerae MS6
Pathway
vcs00010  Glycolysis / Gluconeogenesis
vcs00020  Citrate cycle (TCA cycle)
vcs00620  Pyruvate metabolism
vcs01100  Metabolic pathways
vcs01110  Biosynthesis of secondary metabolites
vcs01120  Microbial metabolism in diverse environments
vcs01130  Biosynthesis of antibiotics
vcs01200  Carbon metabolism
Module
vcs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS6_2143
   00020 Citrate cycle (TCA cycle)
    MS6_2143
   00620 Pyruvate metabolism
    MS6_2143
Enzymes [BR:vcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MS6_2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: BAP03798
LinkDB All DBs
Position
1:complement(2443175..2445070)
Genome map
AA seq 631 aa AA seqDB search
MAIEIYVPDIGADEVEVTEILVKVGDKVAEEQSLITVEGDKASMEVPASQAGIVKEIKVV
AGDKVSTGSLIMVFEAEGAAAAAPAPAPQAAAPVAAAPAAAALKEVQVPDIGGDEVEVTE
IMVKVGDVVAEEQSLITVEGDKASMEVPAPFAGTVKEIKIAAGDKVSTGSLIMVFEVAGA
APVAAPVQAAAPAAAAAPAVAALKEVQVPDIGGDEVTVTEIMVNVGDSISEEQSLITVEG
DKASMEVPAPFAGTLKEIKVAAGDKVKTGSLIMVFEVAGAAPVAAPVQAAPAPAPAAAPA
QASAPAAAAPATSGEFQENHEYSHASPVVRRLAREFGVNLAKVKGSGRKNRILKEDVQNY
VKEALKRLESGAQAAASGKGDGAALGLLPWPKVDFSKFGDTEVQPLSRIKKISGANLHRN
WVMIPHVTQWDNADITELEKFRQEQNAMEAKRDTGMKITPLVFIMKAAAKALEAFPAFNS
SLSDDGESLILKKYVNIGIAVDTPNGLVVPVFKDVNKKGIYELSKELAEVSKKARGGKLT
AADMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSEMKPVWNGKEFAPRLQLPLSL
SYDHRVIDGAEGARFITYLNECLSDIRRLVL
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaaatttatgtacctgacatcggtgcggatgaggttgaagtcactgagatt
ctcgtcaaagtcggcgacaaagtggctgaagagcaatctctgatcacggttgaaggcgac
aaagcttctatggaagttcctgcgtctcaagcgggtatcgttaaagagatcaaagtagtg
gcaggtgacaaagtgtctactggctctctgatcatggtctttgaagcggaaggtgcagca
gcggcagcaccagctcctgcgcctcaagcggcagcaccagttgctgcggctccagcggcc
gctgcactgaaagaagtgcaagtaccagacattggcggtgatgaagttgaagtgactgaa
atcatggtcaaagtgggcgatgtggttgcggaagagcaatctctgatcaccgttgaaggc
gacaaagcgtcaatggaagtacctgcacctttcgctggtacggttaaagagatcaaaatc
gctgcgggcgacaaagtatcaacaggttcactgatcatggtgtttgaagtagccggtgct
gcgccagttgcagcaccagttcaagctgcggcaccagcggcagctgctgctccagctgtt
gcagcactgaaagaagttcaagtacctgatatcggcggtgacgaagtgaccgtaacggaa
atcatggttaacgtgggcgacagcatcagcgaagagcaatctctgatcaccgtagaaggc
gataaggcttctatggaagtaccagcaccttttgctggaactctcaaagagatcaaagtg
gctgcaggcgataaagtgaaaacaggttcgctgatcatggtgtttgaagttgctggcgca
gcgccagtcgcggcaccagttcaagcagcaccagcaccagcacctgcggcagcgcctgct
caagcatcggctcctgcggcggctgcacctgcaacaagtggtgaattccaagaaaaccat
gagtactcacacgcttctccagtcgtgcgtcgtctggctcgtgaatttggtgttaaccta
gccaaagtcaaaggctctggccgcaagaaccgtatcctgaaagaagacgtacagaactac
gtgaaagaagcgctgaaacgtctggaatctggcgcgcaagcggcggcttcaggtaaaggt
gatggcgcagcgctgggcttactgccttggccaaaagtggacttcagcaagttcggtgat
accgaagtgcaaccactgtctcgcatcaagaaaatctcgggtgctaacctgcaccgtaac
tgggtgatgatcccgcacgtgacccaatgggacaatgcagacatcactgagctagagaaa
ttccgtcaagagcaaaacgcgatggaagcgaagcgcgacactggcatgaagatcactccg
ctggtgttcatcatgaaagccgctgcgaaagcgctggaagctttccctgcgttcaactct
tctctgtctgacgatggcgaaagcttgatcctgaagaaatacgtgaacatcggtattgca
gtggatacaccaaatggtctggtggttcctgtgtttaaagatgtgaacaagaaaggcatc
tacgagctgtcaaaagagctggctgaagtctcgaagaaagcccgtggcggtaagctgact
gccgctgacatgcaaggtggctgtttcactatctctagcctaggcggtattggcggtaca
gcgtttaccccaatcgttaacgcacctgaagtggctattttgggtgtgtctaagtctgag
atgaagccagtgtggaacggcaaagagttcgcgccacgtctgcagctgccactgtcactg
tcttacgatcaccgcgtgatcgacggtgcagaaggtgcacgcttcattacttacctgaac
gagtgtctaagcgacatccgtcgtctggtactgtaa

DBGET integrated database retrieval system