KEGG   Vibrio cholerae O1 El Tor MS6: MS6_2268Help
Entry
MS6_2268          CDS       T03666                                 

Definition
(GenBank) inorganic pyrophosphatase
  KO
K01507  inorganic pyrophosphatase [EC:3.6.1.1]
Organism
vcs  Vibrio cholerae O1 El Tor MS6
Pathway
vcs00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:vcs00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MS6_2268
Enzymes [BR:vcs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     MS6_2268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyrophosphatase InPase
Motif
Other DBs
NCBI-ProteinID: BAP03923
LinkDB All DBs
Position
1:2586276..2586806
Genome map
AA seq 176 aa AA seqDB search
MSLNNVPAGKSLPDDIYVVIEIPANADPIKYEVDKESGAVFVDRFMSAPMFYPCNYGYVN
HTLSLDGDPVDVLVPTPYPLIPGSVIRCRPVGVLKMTDESGEDAKVVAVPHTKISKEYDH
IQDVNDLPALLKAQITHFFERYKELESGKWVKVDGWEDAASARAEILSSYERAQNK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaacaatgtgccagcgggcaaatcactgcctgatgatatctatgtagtgatc
gaaatccctgccaatgctgacccaatcaaatacgaagtcgacaaagagtctggcgcagta
ttcgtagaccgctttatgtcagcgcctatgttctacccatgtaactacggttacgtgaac
cacactctgtcactggacggtgacccagtagatgttttggttccaactccataccctctg
atcccaggttctgtgatccgttgccgtcctgttggcgtgctaaagatgacggacgaatcc
ggtgaagatgcgaaagtggttgcggtaccgcacaccaagatctctaaagagtacgatcac
atccaagacgtgaacgatctgccagcgctgctgaaagcacagatcactcacttctttgag
cgttacaaagagctggaatcaggcaagtgggtaaaagtggatggctgggaagatgcagct
tctgctcgcgctgaaatcctgagctcttacgagcgtgcgcaaaacaaataa

DBGET integrated database retrieval system