KEGG   Vibrio cholerae O1 El Tor MS6: MS6_2366Help
Entry
MS6_2366          CDS       T03666                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vcs  Vibrio cholerae O1 El Tor MS6
Pathway
vcs00620  Pyruvate metabolism
vcs00680  Methane metabolism
vcs01100  Metabolic pathways
vcs01120  Microbial metabolism in diverse environments
vcs01200  Carbon metabolism
Module
vcs_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MS6_2366
  09102 Energy metabolism
   00680 Methane metabolism
    MS6_2366
Enzymes [BR:vcs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MS6_2366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 L27
Motif
Other DBs
NCBI-ProteinID: BAP04021
LinkDB All DBs
Position
1:2678788..2681418
Genome map
AA seq 876 aa AA seqDB search
MNEKYAALKSNVSMLGRLLGQTIQAADGDVILAKVETIRKLSKSARAGNQADRELLIEEI
KNLPNHQLTPVARAFNQFLNLTNIAEQYHTISRHCESHVNELDAIGSLFAKLAQKSVSKF
DTAQAIRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSPKERHKTERRLEQ
LIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWHAVPEFLRELDEQVKSYLGEGLPIDA
RPVHFSSWMGGDRDGNPFVTHTITREVLLLSRWKAADLYLTDINELVSELSMTKCNEAVR
ALAGEEHEPYRAILKPIRSLLQETIEILDAKLNGQKLAVKAPLQTADQLWEPLYACYQSL
HECGMGVIADGSLLDTLRRIKAFGVHLVRLDVRQESSRHAEVISELTRHLGIGDYNQWSE
QDKIAFLTTELNSKRPLLPRDWQPSPQVKEVLDTCKIIAAQSKDAFGAYVISMARTASDV
LAVHLLLQEAGCPYRMDVCPLFETLDDLNNAESVIRQLMNIDLYRGFIQNHQMVMIGYSD
SAKDAGVMAAGWAQYRAMEALVKVGEEAGIELTLFHGRGGTIGRGGAPAHAALLSQPPKS
LKGGLRVTEQGEMIRFKLGLPEVAVNSFNMYASAILEANLLPPPEPKNEWRALMDILSEI
SCNAYRKVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPTGGVESLRAIPWIFSWSQ
NRLILPAWLGAGEAIQIAINEGHQALLEEMCREWPFFSTRLGMLEMVYTKCSVSIACHYD
ERLVEPTLRPLGEKLRAQLQQDIKVVLNVENNENLMQSDPWGQESIRLRNIYIEPLNMLQ
AELLYRTRQSELPAPELEEALMVTIAGIAAGMRNTG
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaatacgctgcgctcaaaagtaacgtaagcatgttaggacgactactcggc
cagacaattcaagccgccgatggtgacgttattttagcgaaagtggaaaccatccgaaaa
ctttccaaatctgcccgagcgggcaaccaagcagaccgcgagctgctgatcgaagagatc
aaaaatcttcctaaccaccaactgactcccgtggctcgcgcctttaaccaattcctgaac
ctgaccaatattgccgagcagtatcacaccatctcacgccactgtgaaagccacgtgaat
gagttggatgcgattggtagcctgtttgctaaactggcgcagaagtcggtcagtaaattc
gatacggcgcaagccattcgcgatctcaacattgaactggtattgaccgctcacccgact
gagatcactcgtcgcaccatgatcaacaagctagtcaaaatcaacgaatgtctgtccaaa
cttgagctcagcgacctctctccgaaagagcgccataaaaccgagcgccgccttgagcaa
ttaattgcccaaagttggcattcagatgtgattcgtcagcagcgtccaacgccattagat
gaagccaaatgggggttcgcggtcgtagaaaactcactgtggcacgccgttcctgagttt
ttgcgtgagttagatgaacaggtgaaatcttacctaggtgaaggtttaccgattgatgca
cgccctgtgcatttctcatcttggatgggtggagatcgcgatggtaacccctttgtgacc
cacactatcactcgcgaagtgctgttactgtcacgctggaaagcagccgatttgtatctc
accgatatcaatgaactggtcagcgaactttcgatgaccaagtgtaatgaagccgtacgc
gctttagccggcgaagagcacgaaccttatcgcgccatcctcaagccaatacgaagcttg
ctgcaagagacgattgaaattcttgatgcaaaactcaacggccaaaaactggcagtaaaa
gcccctttgcaaaccgcagatcagttgtgggaaccgctctacgcgtgttaccaatcactg
catgagtgtggcatgggcgtaatcgcagatggttccttgctcgataccctgcgccgcatt
aaagcctttggcgtgcatctggttcgcctcgatgttcgtcaagagagctcacgccatgca
gaagtgatctcggaactgacccgtcatctcggcatcggcgattacaatcagtggagcgag
caagataaaatcgcgttcctgaccacagagctgaactcgaaacgcccactgctaccacgc
gattggcaaccgtcgcctcaagtcaaagaggtgttggatacctgtaagatcatcgctgcg
cagtccaaagatgcctttggcgcttatgtcatttcgatggcgcgtaccgcatcggatgtc
ctcgccgtgcacctgctgctgcaagaggcaggatgtccttatcgtatggatgtttgcccg
ctgtttgaaaccttagatgacttgaacaatgcagaatcggtgatccgtcaactgatgaac
atcgatctgtatcgcggctttattcagaaccaccaaatggtgatgattggttattccgat
tccgccaaagatgcgggggtgatggcagcaggctgggcgcaataccgagcgatggaagcg
ctagtgaaagttggcgaagaagcggggatcgaactcactctattccatggtcgcggcggc
acaattggtcgcggcggtgctcctgcacacgcggcactgctttctcagccaccaaagagt
ttgaagggcggtctgcgtgtaaccgaacaaggcgaaatgatccgctttaaactgggtcta
cctgaagtggcggtcaacagctttaacatgtacgccagcgctattttggaagccaactta
ctacccccaccagagcctaaaaatgagtggcgtgcgctgatggatattctgtcggaaatt
tcatgtaatgcttaccgaaaagtcgtgcgtggtgaaccagactttgttccttacttccgt
caagccacaccagaattagaactcggcaagctgccattgggttccagacccgccaaacgt
aatcctactggtggagtcgagagcctgcgagccattccatggatcttctcatggagccag
aatcgtctcattcttcctgcttggctaggtgcgggtgaagcgatccaaattgccattaat
gaaggacaccaagcgctacttgaagagatgtgccgcgaatggccattcttctcaactcgc
cttggcatgctggaaatggtgtacaccaaatgcagtgtaagcatcgcgtgtcattatgat
gagcgacttgttgaaccgactttgcgtccattgggtgaaaaattgcgtgctcaattacag
caagacattaaagttgtgctgaacgttgagaataacgagaacctgatgcaaagcgatcct
tggggacaagagtcgattcgtctgcgtaacatctatattgaaccactcaacatgctgcaa
gcagaactgctgtatcgtacccgtcaatcagaacttcctgctccagaactggaagaagcc
ttgatggtgaccattgcgggaattgcggcgggaatgcgcaatactggttaa

DBGET integrated database retrieval system