KEGG   Vibrio cholerae O1 El Tor MS6: MS6_A0057Help
Entry
MS6_A0057         CDS       T03666                                 

Definition
(GenBank) phosphate transport ATP-binding protein PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
vcs  Vibrio cholerae O1 El Tor MS6
Pathway
vcs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vcs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MS6_A0057
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vcs02000]
    MS6_A0057
Enzymes [BR:vcs01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     MS6_A0057
Transporters [BR:vcs02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    MS6_A0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 RsgA_GTPase AAA_23 AAA_16 AAA_15 Rad17 AAA_29 AAA_18 AAA_30 AAA_25 ATPase_2 AAA_5 AAA Adeno_IVa2 AAA_33 AAA_28 NB-ARC NACHT RNA_helicase AAA_14
Motif
Other DBs
NCBI-ProteinID: BAP04316
LinkDB All DBs
Position
2:75633..76388
Genome map
AA seq 251 aa AA seqDB search
MKTTKFNIENLDLFYGENQALKSINLPIPTRQVTALIGPSGCGKSTLLRCLNRMNDLIEG
VTITGKLTMDGQDVYGNIDVSDLRIRVGMVFQKPNPFPMSIYENVAYGLRAQGIKDKKHL
DEVVERSLRGAALWDEVKDRLKSHAFGLSGGQQQRLCIARTIAMEPDVILMDEPTSALDP
IATHKIEELMEDLKKNYTIVIVTHSMQQARRISDRTAFFLMGELVEHDDTQVIFSNPRDD
RTRGYVNGDFG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaccaaattcaacattgaaaacctcgacctgttttacggtgagaaccaagcc
ctgaaatcgattaatctgccgattcctacgcgtcaagtgacagcactgattggcccctct
ggttgcggtaaatcaaccctgttgcgctgcctgaatcgtatgaatgatctcattgaggga
gtcacaattaccggtaagctgaccatggatggccaagatgtgtatggcaatatcgatgtg
tctgatctgcgtatccgcgttggtatggtgttccaaaaacccaacccattcccaatgagt
atttatgaaaacgtggcctatggtctgcgtgcgcaaggtatcaaggacaaaaagcatctt
gatgaagtggttgaacgttcactgcgtggcgcagcgctgtgggatgaggtaaaagatcgt
cttaaatctcatgcctttggtttatcaggtggccagcagcagcgtctttgtatcgcgcgc
accatcgccatggaacccgatgtgatcttgatggatgagccgacttcggcacttgacccg
attgcgacccacaaaattgaagagctgatggaagatctgaagaagaactacaccatcgtt
atcgtgactcactcaatgcagcaagcgcgccgtatttcagaccgtactgcattcttctta
atgggtgagttggttgaacacgatgacactcaagtcattttcagtaacccacgcgatgat
cgtacccgtggttatgtgaatggtgattttggttaa

DBGET integrated database retrieval system