KEGG   Vibrio cholerae O1 El Tor MS6: MS6_A0848Help
Entry
MS6_A0848         CDS       T03666                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
vcs  Vibrio cholerae O1 El Tor MS6
Brite
KEGG Orthology (KO) [BR:vcs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vcs03016]
    MS6_A0848
Enzymes [BR:vcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     MS6_A0848
Transfer RNA biogenesis [BR:vcs03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    MS6_A0848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB CSD2 S1
Motif
Other DBs
NCBI-ProteinID: BAP05107
LinkDB All DBs
Position
2:760126..762162
Genome map
AA seq 678 aa AA seqDB search
MFQDNPLLAQLKQKIQETLPKKEGTIKASDKGFGFLEVDSKTSYFVPPPYMKKCMHGDKV
VAFIRTENEREVAEPSELIEQSLTRFIGRVKLFKGKLNVAPDHPQLKKLSLKAKTKKGLN
EADFQEGDWVVAHLVRHPLKGDDGFFVQISHKITDANDKIAPWWVTLAENDLPNSEPAGI
DDWQLKDDADLVREDLTALPFVTIDGESTKDMDDALYAQQLPNGDFALTIAIADPTAYIT
PEDEMDKVARERGFTIYLPGRNIPMLPRDLADELCSLMENQVRPALCCSVTIRKDGVIGD
DIRFFAANIKSHARLVYDHVSDWLETGSSEQWQPSEEIAQVVRDLYAFSQARANWRETHA
VVFPDRPDYRFELSADNDVVAIHADMRRTANRLVEESMITANICAGKTLQTTFGFGVFNT
HAGFKAEKMADVVELMAVNGAPNADAETLATVEGFAALRRWLATQETSYLDNRIRKYQSY
SEIGNQPLPHFAMGLDVYATWTSPIRKYGDMINHRLLKAHILGKAPVQTPDETVGEELAL
HRKHHKIAERNVADWLYARTLADEPAKETRFQAEIFDINRPGMRVRLLENGAMAFIPGAL
ILDNKERIECNGEDGTVLIDKEVVYKLGDVLEIVLTEVNQENRSLVGKPTQVFADLVSET
QTSAEQPAEGAENNEPQV
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgttccaagacaatccgctcctcgcgcagcttaagcaaaaaatccaagaaactctgcct
aaaaaagaaggcaccatcaaagccagtgacaaaggttttggcttcctcgaagtcgatagc
aaaaccagctactttgttccgcctccttatatgaagaagtgtatgcatggcgacaaagtc
gtggctttcatccgcaccgaaaatgaacgcgaagtggctgagccttctgaactcatcgag
caatcgctgactcgcttcattggtcgcgtaaagctatttaaaggcaaactcaacgtcgcg
cccgatcatccacaactgaaaaagctgtcgctgaaggcaaaaaccaagaaaggcctcaac
gaagctgacttccaagagggtgactgggtggtcgctcatcttgtgcgccacccgctgaaa
ggtgacgatggtttctttgtgcagatttcacacaaaatcaccgatgctaatgacaaaatt
gccccttggtgggtgacattagcggaaaacgatctgcccaacagcgagccagcgggcatt
gacgattggcaactgaaagatgatgcagacttggttcgtgaagatctgaccgcgctgcct
tttgtgactatcgatggtgaatcgaccaaagatatggacgacgcgctttacgcacagcaa
ctgccaaacggtgattttgcgctgactatcgcgattgccgatccaaccgcttacatcacc
ccagaagatgagatggacaaagttgctcgcgagcgtggctttaccatttatttgccgggt
cgcaacattcccatgttgccacgcgatctggctgatgagctttgctctctgatggaaaac
caagttcgtccagcgctatgctgctcagtcactatccgtaaagatggcgtgattggcgat
gatattcgtttcttcgcagccaacatcaaatctcatgcacgcctagtttacgaccatgtt
tctgactggttggagactggcagctcggaacaatggcaaccaagcgaagaaatcgcccaa
gtagtgcgcgacctctacgctttctcacaagcacgtgcgaactggcgtgagacccatgcc
gtagtgttcccagatcgtccagactaccgcttcgaactgagtgccgataacgatgtggtg
gcgatccatgcggacatgcgccgtacggcaaaccgcttggttgaagaatcgatgatcact
gcgaacatctgtgcgggtaaaacgctgcaaactacatttggttttggtgtattcaatacc
cacgcgggttttaaagctgaaaaaatggccgatgtagtagagctcatggcggtcaacggc
gcacccaatgcggatgcagaaacgctggcaaccgtggaaggctttgccgctctgcgccgc
tggctagccacgcaagaaaccagctacctcgataatcgtattcgtaaataccaaagctac
agtgagattggtaaccagcctctcccccacttcgcgatgggccttgatgtgtacgcaaca
tggacttcgccgattcgtaaatacggcgacatgattaaccaccgtctgctgaaagcgcac
attctcggcaaagccccggtgcaaacgccggatgagacagttggtgaagaactggctctg
caccgtaaacaccacaaaattgctgaacgtaatgtggcagattggctctatgcgcgcacg
ctggctgatgagcctgcgaaagaaacccgcttccaagctgagatctttgatatcaaccgt
ccgggcatgcgtgttcgcttactcgaaaatggcgcaatggcctttattccgggagctctg
atcctcgataacaaagagcgtatcgagtgtaatggtgaagacggcacggtactgatcgat
aaagaagtggtgtacaaacttggtgatgtgctggaaatcgtcctgacagaagtcaatcaa
gaaaaccgcagcttagtgggtaaaccaacgcaagtgtttgctgatctggtttcagagacg
caaaccagtgcggagcaacctgctgagggcgcagaaaataacgagccacaagtttaa

DBGET integrated database retrieval system