KEGG   Vibrio coralliilyticus OCN014: JV59_01735Help
Entry
JV59_01735        CDS       T03497                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
vct  Vibrio coralliilyticus OCN014
Pathway
vct00790  Folate biosynthesis
vct01100  Metabolic pathways
Module
vct_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vct00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    JV59_01735 (folP)
Enzymes [BR:vct01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     JV59_01735 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind GDPD_2
Motif
Other DBs
NCBI-ProteinID: AIS53903
LinkDB All DBs
Position
1:354656..355486
Genome map
AA seq 276 aa AA seqDB search
MIITANNKSLDLSTPQVMGILNVTPDSFSDGGKYNSLENAMIQAEKMINAGVSIIDIGGE
STRPGAPDVALEEELIRVIPVIKAIRERFDVWISIDTSKAEVMRQAVKAGADIINDVRAL
QEPGALEVAAESGLPVCLMHMQGQPRTMQANPHYDDLLKEVGKFLQERVQACEAKGMKKS
QLILDPGFGFGKTLEHNYHMLANLEQFHQFGLPLLAGMSRKSMLFKLLDKAPAECVAASV
SCATIAAMKGAQIIRVHDFEQTLDAVKIVSMVQSNH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattattacagcaaataataaatccctcgacttatcaacgcctcaagttatgggtatt
ctcaacgtcacgcctgactcgttctctgatggtggaaaatacaattcactagagaatgcg
atgattcaggcagaaaagatgattaacgcaggcgttagtattatcgacatcggcggcgag
tcgactcgccctggtgcacctgatgtggctttggaagaagagcttattcgggtgatcccg
gtgatcaaagccattcgtgaacgctttgacgtatggatttcaattgataccagcaaagca
gaagtcatgcgtcaggctgttaaagcaggggcggacattattaatgatgttcgggcactg
caagagccaggtgcgcttgaggttgctgcagaatcggggttaccggtgtgtctgatgcac
atgcaaggacagccaagaaccatgcaggcaaatcctcattacgacgatttacttaaagaa
gttggtaaattcctgcaagaaagagtacaagcatgtgaagccaaagggatgaaaaagagt
caattgatccttgacccgggttttggttttggaaaaacgcttgaacacaactatcacatg
ttggctaaccttgagcaatttcatcaatttggcttaccgcttctggctggtatgtctcgt
aaatcgatgttgtttaagttgctggataaagcgcctgccgagtgtgttgctgccagtgtt
agctgcgcgacaattgctgcaatgaaaggtgctcagatcatccgagttcatgactttgaa
caaacgcttgatgctgtaaagattgtctctatggtgcaaagtaaccactga

DBGET integrated database retrieval system