KEGG   Vibrio coralliilyticus OCN014: JV59_19105Help
Entry
JV59_19105        CDS       T03497                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vct  Vibrio coralliilyticus OCN014
Pathway
vct00473  D-Alanine metabolism
vct00550  Peptidoglycan biosynthesis
vct01100  Metabolic pathways
vct01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vct00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    JV59_19105
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JV59_19105
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    JV59_19105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vct01011]
    JV59_19105
Enzymes [BR:vct01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     JV59_19105
Peptidoglycan biosynthesis and degradation proteins [BR:vct01011]
 Precursor biosynthesis
  Amino acid ligase
   JV59_19105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST SfsA
Motif
Other DBs
NCBI-ProteinID: AIS57146
UniProt: A0A2A2CUZ2
LinkDB All DBs
Position
2:complement(704343..705332)
Genome map
AA seq 329 aa AA seqDB search
MANTTILLLCGGGSAEHEVSLVSADFVQSQLELTPDFEVIRVEMKPEGWYQGEQLVYLDT
NAGTLNSEVNATKLDFVVPCIHGFPGETGDIQSMLELTGIPYLGCGPEASTNSFNKITSK
LWYDALSIPNTPYIFLSENNKQAYDQSLAAFEQWGSVFVKAARQGSSVGCYKVTEKDQLQ
KAINDAFGYSDQVLVEKAVKPRELEVAAYEYKGQLHVTPPGEIKAPEDTFYSYEEKYSAD
SHSTTDVEASNLTDDQRLIIQQASEKVFKQMRLRHLSRIDFFLTPEGNVYLNEVNTFPGM
TPISMFPKMVEHSGLKFSEFLADCVKSSL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatacaacaattttactactttgtggtggcggttctgctgagcatgaagtgtcg
ctcgtttcagcagatttcgtacaatcccaacttgagctaacacctgactttgaggtgatt
agagtagaaatgaaacctgaaggttggtatcaaggtgagcaactggtttatctcgataca
aacgctggaaccttgaactctgaagtaaatgcaacaaaattggattttgttgttccatgt
attcatggctttccgggggaaactggtgatatccaatcgatgctcgaactgacaggcatt
ccttatttaggctgtggacctgaagcaagtacgaatagctttaacaaaatcacgtccaaa
ctctggtacgatgcactttccattccaaatacgccttatatctttttgtcagagaataat
aagcaggcatatgatcaaagcttagcggcgttcgagcaatggggaagtgtattcgttaaa
gctgcaagacagggttcttctgttggctgctataaagtgacagaaaaagatcaactgcaa
aaagcaatcaatgatgcgtttggatattcagatcaagtcttagtcgaaaaagcagtaaag
ccccgcgagttagaggttgcagcgtatgaatataaaggccaattgcatgtgacgccacct
ggagaaattaaagctccagaagacacgttctattcatacgaagagaaatacagtgcagat
agtcattcgacaacagatgttgaagcgtcgaatcttacagacgatcaacgacttattatc
caacaagcttctgagaaagtgttcaaacaaatgaggctacgtcacttgtctcgaattgat
ttctttttaactccagaaggaaatgtgtacttgaatgaagtgaacaccttcccaggaatg
acaccaatttcgatgttcccgaaaatggttgagcatagtgggctaaagttctcagaattt
cttgctgattgcgtcaagagctcactttag

DBGET integrated database retrieval system