KEGG   Vibrio coralliilyticus OCN014: JV59_28025Help
Entry
JV59_28025        CDS       T03497                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vct  Vibrio coralliilyticus OCN014
Brite
Enzymes [BR:vct01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     JV59_28025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIU66245
UniProt: A0A097QIF8
LinkDB All DBs
Position
1:complement(769624..770208)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKKADGSLDIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccagctcttccttacgcgaaagacgcgctagaaccacatatctca
gcagagactctagatttccaccacggtaagcaccacaacacttacgtagttaagctaaac
ggtcttatcccaggtactgagttcgaaggcaaaacgctagaagaaatcatcaaaacgtct
actggcggcgtattcaacaacgcagcacagatctggaaccacacgttctactggcactgt
ctagctccaaacgcgggcggtgaaccaacaggcgcagttgctgacgcaatcaacgctgca
ttcggttctttcgaagagttcaaagcgaagttcactgattcagcaatcaacaacttcggt
tcttcttggacttggctagttaagaaagctgacggctctctagacatcgttaacacctct
aacgcagccactcctctaacagaagaaggtacaactccacttcttactgttgacctatgg
gaacacgcttactacatcgattaccgtaacgttcgtccagactacatgaatggtttctgg
gcgctagttaactgggacttcgtagcagaaaacctagctaaataa

DBGET integrated database retrieval system