KEGG   Vibrio coralliilyticus OCN014: JV59_34350Help
Entry
JV59_34350        CDS       T03497                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vct  Vibrio coralliilyticus OCN014
Pathway
vct00220  Arginine biosynthesis
vct00250  Alanine, aspartate and glutamate metabolism
vct00290  Valine, leucine and isoleucine biosynthesis
vct01100  Metabolic pathways
vct01110  Biosynthesis of secondary metabolites
vct01130  Biosynthesis of antibiotics
vct01210  2-Oxocarboxylic acid metabolism
vct01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vct00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JV59_34350
   00290 Valine, leucine and isoleucine biosynthesis
    JV59_34350
   00220 Arginine biosynthesis
    JV59_34350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vct01007]
    JV59_34350
Enzymes [BR:vct01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     JV59_34350
    2.6.1.66  valine---pyruvate transaminase
     JV59_34350
Amino acid related enzymes [BR:vct01007]
 Aminotransferase (transaminase)
  Class I
   JV59_34350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIU67363
UniProt: A0A097QLM3
LinkDB All DBs
Position
1:2176989..2178203
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYIGNGASELIVMAMQALLNNGD
EMLVPAPDYPLWTASVALSGGKAVHYLCDEQADWYPDLDDIRKKITPKTRGIVLINPNNP
TGAVYSRDFLLEVIEIARQHKLIIFADEIYDKVLYDGATHTSVATLSDDVLTVTFNGLSK
AYRVCGFRGGWMFLTGPKHLAQGYVNGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAFELINQIPGVSCVKPKGAMYLFPKIDTKMYNIKDDQKMVLDFLIQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEMAIGRFERFLSTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgataatgtctgctatgacattagggggcct
gtactcaaacatgctaagcgcatggaggaagaggggcataaaatactgaagttgaatatc
ggtaatcccgccccatttggatttgacgccccagatgaaatcttggttgatgtcattcgc
aacctaccgacttcacaaggttactgtgactcgaaaggcatctactctgctcgtaaagcc
gtcgttcagcactatcaacgtaaaggcatccgttctttagatgtcgaagacgtgtatatc
ggtaatggcgcatcagagctgatcgttatggcgatgcaggctttgctcaacaatggcgat
gaaatgctggtcccggctccggattacccgctttggacagcctctgttgccctatctggc
ggaaaagccgtgcattacctttgtgatgaacaagcagactggtacccagatctagatgat
attcgcaagaaaatcacaccaaagacccgtggtatcgtcttaattaaccctaataaccca
acaggtgcagtctatagccgcgactttctattagaagtgattgagattgcccgtcagcac
aagctgatcatcttcgctgacgaaatctacgataaagtactctatgacggcgcaacacac
acctctgttgcgacactctcagatgatgtactgactgttacctttaacggcttatctaaa
gcttatcgcgtttgtggtttccgtggtggctggatgttcctcaccggcccgaaacatctc
gcgcaagggtacgttaatggcttagatatgctggcttcaatgcgtttgtgtgccaatgta
ccgatgcaacatgcaattcagaccgcactgggtggttatcaaagtattaatgaactgatc
ctgcccggcggccgcttattggagcagcgtgaccgcgcttttgaactgatcaaccagatt
ccaggggtttcctgcgtgaagcctaaaggcgcaatgtatctgttcccgaaaatcgacact
aagatgtacaacatcaaagatgatcaaaagatggttctcgacttcctgattcaggagaaa
gttctgttggttcaaggctcaggcttcaactggccaaaacccgatcacttccgcattgtt
accctgccacacgttgaagatctcgaaatggcgattggacgctttgaacgcttcctgtcg
acgtatagccagtag

DBGET integrated database retrieval system