KEGG   Vibrio cholerae O49 1154-74: VAA049_1671Help
Entry
VAA049_1671       CDS       T03828                                 

Definition
(GenBank) alpha amylase, catalytic domain protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx00500  Starch and sucrose metabolism
vcx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VAA049_1671
Enzymes [BR:vcx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VAA049_1671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase UxuA Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: AKB04635
UniProt: A0A3A3YHY7
LinkDB All DBs
Position
1825550..1826950
Genome map
AA seq 466 aa AA seqDB search
MKSSYLVLCATFAAASFTSSVQAEAILHAFNWKYADVTANAAQIAAAGYKKVLISPALKS
SGNEWWARYQPQDLRVIDSPLGNKTDLQTLIKTLQDYGVEVYADVVFNHMANESWKRSDL
NYPGSEVLASYTNQAYYYQQQKLFGDLSHNLFSQNDFHPEGCITDWGNPGHVQYWRLCGG
AGDRGLPDLDANAWVINQQRAYLQALKQMGIRGFRIDAVKHMSQYHIDQVFTPEIISGMH
VFGEVITSGGQGDGSYDAFLAPYLNNTTHAAYDFPLFASIRAAFSYQGSMSQLHDPQAYG
QALPNARAITFAITHDIPTNDGFRYQILNPQDEQLAYAYLLGKDGGTPLIYSDDLADHED
KDNGRWANVWNQPSMQHMLRFHNAMQGKPMTVMYSDSCLLLFKRGKEGVVGINKCGESKN
VTIDTYQHEFNWYQTYQDTLSDDRFSVSSRYHTLTIPARVARMWML
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatcgtatcttgttctttgtgccacattcgcggcagcaagttttactagcagc
gtacaagcagaagccattttgcatgcttttaactggaaatatgcagatgtcactgcgaat
gcagcacagatcgccgccgcaggttataaaaaagtgctgatctcaccagcattgaaatcc
agcggtaatgaatggtgggctcgctaccaacctcaagatctgcgagtcattgactcacct
cttggcaacaaaactgacttacaaacactgatcaaaacgctgcaagattacggtgttgaa
gtatatgcggatgtggtgtttaaccatatggcaaacgaaagttggaagcgtagtgatctc
aattatccgggcagcgaagtactagccagctacactaaccaagcttattactatcaacaa
cagaaactgttcggtgatttgtcgcacaatctcttttcacaaaatgattttcatcctgaa
ggttgtattactgattggggcaaccccggtcatgttcagtattggaggctatgcggtggc
gcaggtgatcgcggtctaccagacttggatgccaacgcttgggtcatcaatcaacagcga
gcctatttacaagcgcttaagcaaatgggtatcagaggatttcgaattgatgcggttaag
cacatgagtcaataccacattgaccaagtcttcacaccagagattatttcgggcatgcat
gtgtttggcgaagtgatcacgagtgggggtcaaggtgatggcagttatgatgccttccta
gctccttatctgaataacaccacacacgccgcatacgactttcctctatttgcctccatt
cgtgccgcattttcttatcaaggttcgatgagtcaattgcatgatccacaagcctatgga
caagcattaccaaacgcccgcgccatcacgtttgcgattacccatgatattcccactaat
gatgggttccgttatcagatcctcaacccgcaagatgagcaactcgcttacgcttatcta
ctcgggaaagatggtggaacaccgctgatttatagtgatgatctggctgatcacgaagat
aaagataatggtcgttgggcgaatgtttggaatcaaccatcaatgcaacatatgctgcgc
ttccataacgcaatgcaaggtaaacctatgacggttatgtatagcgactcatgtttgctg
ctcttcaaacggggtaaggaaggtgtcgtaggtattaataaatgtggtgagtcaaaaaat
gtcaccatagatacttatcagcatgaatttaactggtatcagacctatcaagatacttta
agtgacgaccgttttagcgtgagcagtcgctaccatacgttaactatcccagcacgtgtt
gcgcgcatgtggatgctgtaa

DBGET integrated database retrieval system