KEGG   Vibrio cholerae O49 1154-74: VAA049_2102Help
Entry
VAA049_2102       CDS       T03828                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx00260  Glycine, serine and threonine metabolism
vcx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VAA049_2102 (tdh)
Enzymes [BR:vcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     VAA049_2102 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like UDPG_MGDP_dh_N Pyr_redox_3 FAD_binding_2 Pyr_redox_2 FAD_oxidored Methyltransf_25 2-Hacid_dh_C Pyr_redox TrkA_N MTS
Motif
Other DBs
NCBI-ProteinID: AKB04614
LinkDB All DBs
Position
2335055..2336086
Genome map
AA seq 343 aa AA seqDB search
MKIKALSKLKPEQGIWMNEVDMPELGHNDLLIKIKKTAICGTDVHIYNWDEWSQKTIPVP
MVVGHEYVGEVVGIGQEVRGFQIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRT
GCFSEYLVIPAFNAFKIPDGISDDLASIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIM
AAAVAKHVGARHVVITDVNEYRLDLARKMGVTRAVNVAEQNLEDVMKELGMTEGFDVGLE
MSGVPSAFSAMLKTMNHGGRIALLGIPPSSMAIDWNQVIFKGLMIKGIYGREMFETWYKM
ASLIQSGLDISPIITHHFKVDDFQKGFDIMRSGASGKVILDWQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaagcactttcaaaactgaaaccggagcagggcatctggatgaacgaagtg
gacatgcctgagcttggccacaacgacctgctgatcaaaattaagaaaactgccatttgt
ggtacggatgtacacatttataactgggatgagtggtcacaaaaaaccattccagtgcct
atggtggttggccatgaatatgtgggtgaagtggttgggattggccaagaagtgcgtggc
ttccaaattggtgatcgcgtttctggtgaaggccacatcacttgtggtcactgccgtaac
tgccgtggcggccgtacgcacttgtgccgcaacaccattggtgtgggtgtaaaccgcacc
ggttgtttctctgaatatttggtgatccctgcatttaacgcattcaagatcccggatggt
atttcagatgatctggcgtctattttcgacccgtttggcaacgctgtacatactgcgctt
tcattcgacttagtgggtgaagatgtgcttatcaccggtgctggcccaatcggcattatg
gccgctgcggttgcaaaacacgtaggtgcacgccatgtggtgatcaccgatgtgaacgaa
taccgcctcgatttagcccgtaaaatgggtgtgactcgcgcagtgaatgtcgctgagcaa
aacctagaagatgtgatgaaagagcttggcatgaccgaaggttttgatgtgggcttagag
atgtctggtgtaccgagtgcgtttagcgccatgctaaaaaccatgaaccacggtggccgc
atcgctctgttaggtattccaccatcatctatggcgattgattggaaccaagtgatcttc
aaaggtctgatgatcaaaggcatctacggccgtgagatgtttgaaacttggtataagatg
gcgagcctgatccaatcgggtctcgatatcagcccaatcattacacaccacttcaaagtg
gatgacttccaaaaaggcttcgacatcatgcgcagcggggcttccggcaaagttatcctc
gattggcagtaa

DBGET integrated database retrieval system