KEGG   Vibrio cholerae O49 1154-74: VAA049_2705Help
Entry
VAA049_2705       CDS       T03828                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx00071  Fatty acid degradation
vcx00280  Valine, leucine and isoleucine degradation
vcx00281  Geraniol degradation
vcx00310  Lysine degradation
vcx00362  Benzoate degradation
vcx00380  Tryptophan metabolism
vcx00410  beta-Alanine metabolism
vcx00640  Propanoate metabolism
vcx00650  Butanoate metabolism
vcx00903  Limonene and pinene degradation
vcx00930  Caprolactam degradation
vcx01100  Metabolic pathways
vcx01110  Biosynthesis of secondary metabolites
vcx01120  Microbial metabolism in diverse environments
vcx01130  Biosynthesis of antibiotics
vcx01200  Carbon metabolism
vcx01212  Fatty acid metabolism
Module
vcx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    VAA049_2705 (fadJ)
   00650 Butanoate metabolism
    VAA049_2705 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VAA049_2705 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VAA049_2705 (fadJ)
   00310 Lysine degradation
    VAA049_2705 (fadJ)
   00380 Tryptophan metabolism
    VAA049_2705 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VAA049_2705 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VAA049_2705 (fadJ)
   00281 Geraniol degradation
    VAA049_2705 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAA049_2705 (fadJ)
   00930 Caprolactam degradation
    VAA049_2705 (fadJ)
Enzymes [BR:vcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VAA049_2705 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VAA049_2705 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VAA049_2705 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 SSTK-IP
Motif
Other DBs
NCBI-ProteinID: AKB02453
UniProt: A0A0F2TSY0
LinkDB All DBs
Position
complement(2989344..2991470)
Genome map
AA seq 708 aa AA seqDB search
MDNNNAFQLSFDEQHYAWLAIDVPGEKMNTLQAAFAEEMQAVFATLNEKRGQIKGLIIHS
LKPDNFIAGADVRMLEACQSVHEAQALASQGQQMFQQLADLPFPVVAAIHGPCLGGGLEL
ALACDYRVCTEDEVTRLGLPEVMLGLLPGSGGTQRLPRLIGLLPALDLILTGKQLRAKKA
KKLGVVDACVPHSVLLDVAKRLLEEKGHKKRAQVTLPIKEKLLANTGLGRKLIFDQAAKK
TQQKTRGNYPAAQAILEVIQYGLEKGMHAGLEYEAKRFAELVMTRESKALRSIFFATTEM
KKDLGADAKPAPVAAVGVLGGGLMGAGISHVTVAKAKTSVRIKDVANDGVLNALNYNYKL
FDKQRQRKILTKAQLQAQMSQLSGGTGFVGFDRCDVVIEAVFEDLKLKQQMVADIEANAK
PTTIFATNTSSLPIHQIASQAQRPQNIVGLHYFSPVEKMPLVEVIPHATTSDETIATVVT
LARKQGKTPIVVKDCAGFYVNRILAPYMNEAAQVLMAGEPIEKLDAALLDFGFPVGPITL
LDEVGVDIGAKIMPILVKELGPRFQGPDVFDVLLKDNRKGRKSGKGFYTYKGSKKKEVDK
SVYKLLKLTPESKLNDKEIAMRCLLPMLNEAVRCLDEGIIRSARDGDMGAIFGIGFPPFL
GGPFRYMDTLGLTKVVEMMNQHTEKYGERFAPCDGLLTRAGLGEKFYP
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggataacaacaatgcatttcagctctcgtttgatgagcagcattacgcttggctggcg
attgatgtcccgggcgaaaaaatgaataccctgcaagcggcatttgcagaagagatgcaa
gccgtttttgcaacgctcaatgaaaagcgaggacagatcaaagggctgattatccactct
cttaagccggataactttattgcgggtgcggatgtccgcatgttggaagcttgccaatcg
gtacatgaagcacaagcgttagcctcgcaggggcaacagatgttccagcagcttgccgat
ttacctttccctgtggtcgcggcgattcacggcccttgcttaggcggtggtttagaattg
gctctggcgtgtgattatcgtgtctgtactgaagatgaggtaacacgtctaggcttacca
gaagtgatgttgggtttgcttccgggctctggcgggacacagcgtttaccacgtttgatt
ggtttactgcctgcgctggatctcatcttaacgggcaaacaattgcgtgccaaaaaggcc
aagaaattgggtgtggttgatgcatgtgttccgcactcagtactgttggatgtggccaaa
cgtcttctagaagaaaaagggcacaaaaagcgcgctcaagttacgctaccgatcaaagaa
aaactgctcgccaatactggcttggggcgtaagttgatttttgaccaagcggccaagaaa
acgcagcagaaaacccgtggcaactaccccgcagcgcaagccattttagaggtcattcag
tatggcctagaaaaagggatgcatgccggcttggaatatgaagccaagcgtttcgctgaa
ctggtgatgacccgagaatcgaaagcactgcgctccattttctttgcgaccacagagatg
aaaaaagatctcggtgcggatgccaaacccgcacctgtggcggctgtgggcgtgctcggt
ggtggtttgatgggggctggcatcagtcacgttactgtggcgaaagccaaaacatcggtg
cgcatcaaagatgtggcgaatgatggtgtgctcaatgccctcaattacaactacaagctg
tttgataagcagagacagcgcaagattttgactaaagcacagctgcaagcgcagatgtcg
cagctctcgggtgggactggctttgtgggttttgatcgctgtgatgtagtgatagaggct
gtgtttgaagacctgaaacttaagcaacaaatggtggcggatattgaagcgaatgccaaa
ccgacaacgatttttgcgaccaacacatcctcgctgccgatccatcagatcgcgagccaa
gcgcagcgtccgcaaaatattgtgggtttacattatttcagcccagttgaaaaaatgccg
ttggtggaagtgattcctcacgcgaccacctcggatgaaaccattgcgaccgtggtgaca
ttggcacgtaagcagggcaaaacaccgattgttgttaaagactgtgccggtttttatgtc
aaccgcattttagcgccttatatgaatgaagccgcgcaagtgctgatggcgggtgaacct
atcgaaaaactcgatgctgcgttactggattttggtttcccagtggggcctatcaccttg
cttgatgaagtaggggtcgatatcggagccaagatcatgccgattttggttaaagagctt
gggccgcgtttccaaggaccggacgtgtttgatgtgttgttgaaagataaccgtaaaggc
cggaaaagcggtaaaggtttctacacctacaaaggcagcaaaaagaaagaagtcgataaa
tcggtttataaactgctgaagttaaccccggaatctaagctaaacgacaaagaaatcgcg
atgcgttgcttgttgcctatgctcaatgaggcggttcgttgtctcgatgaaggcattatt
cgcagtgcacgtgatggcgatatgggcgcgatttttggcatcggtttcccgccgttctta
ggtgggcctttccgttacatggacacgcttggtttaaccaaagtggtggaaatgatgaac
caacacaccgagaaatatggagagcggtttgctccatgtgacggtttgttgacgagagcg
ggattgggcgagaagttctacccctag

DBGET integrated database retrieval system