KEGG   Vibrio cholerae O49 1154-74: VAA049_2706Help
Entry
VAA049_2706       CDS       T03828                                 

Gene name
fadI
Definition
(GenBank) acetyl-CoA C-acyltransferase FadI
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx00071  Fatty acid degradation
vcx00280  Valine, leucine and isoleucine degradation
vcx00281  Geraniol degradation
vcx00362  Benzoate degradation
vcx00592  alpha-Linolenic acid metabolism
vcx01100  Metabolic pathways
vcx01110  Biosynthesis of secondary metabolites
vcx01120  Microbial metabolism in diverse environments
vcx01130  Biosynthesis of antibiotics
vcx01212  Fatty acid metabolism
Module
vcx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VAA049_2706 (fadI)
   00592 alpha-Linolenic acid metabolism
    VAA049_2706 (fadI)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VAA049_2706 (fadI)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    VAA049_2706 (fadI)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAA049_2706 (fadI)
   00642 Ethylbenzene degradation
    VAA049_2706 (fadI)
Enzymes [BR:vcx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     VAA049_2706 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKB04953
LinkDB All DBs
Position
complement(2991470..2992777)
Genome map
AA seq 435 aa AA seqDB search
MGKQEVRTRSGERVAIVAGLRTPFARQSTEFGQVPAVDLGKMVVQEMMARTAIDPELIEQ
VVFGQVVQMPEAPNIAREIVLGTGMSINTDAYSVTRACATSFQAAVNVAESIMAGSIDIG
IAGGADSSSVLPIGVSKKLAASLLALSKTKTVGQKLKLLSNLSFKDLMPVPPAVAEYSTG
LSMGQTAEQMAKSYAISRAEQDALAHRSHTLAAQAWAEGKIRDEVMTAFPEPYKKWLDMD
NNIRMDSKLESYAKLRPAFDRQYGSVTAANSTPLTDGAAAIMLMREGKAKELGLEIMGYI
RSYAFAAIGVEKDMLMGPSYATPIALDRAGITLNDLTLIDMHEAFAAQTLANLKMFASDK
FAQEQLGRAQAIGEVDMSKFNVLGGSLAYGHPFAATGARMITQTLRELKRRGGGLALNTA
CAAGGLGAAMILEVE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcaggaagtcaggactcgttctggagaacgagtggcgattgtggccgggcta
cgtacgccgtttgcgcgtcaaagcaccgagtttggtcaagtacccgcagtcgatctcggc
aaaatggtagtacaagagatgatggcgcgcaccgctatcgatcctgaattaattgagcaa
gtggtgtttggccaagtggtacagatgccagaagcgccgaatattgctcgagaaattgta
ctaggtaccggaatgtcgattaacacggatgcctacagcgttactcgcgcttgcgccact
agttttcaagccgccgtcaatgtggccgaaagtatcatggctggcagcatagatattggt
attgcaggtggtgcggattcttcttctgttctgccgattggtgtttctaaaaaactggcg
gcttctttattagccttgagtaaaactaagacggtcgggcagaaacttaaactgctcagt
aacctctcttttaaagacttgatgcccgtacctcctgcggtcgcggaatattcaacgggt
ctttcgatggggcaaactgctgagcagatggccaaaagctatgcgatttcgcgcgctgag
caagatgcgttagcacatcgttcacatactttagcggctcaagcatgggcagagggcaaa
attcgcgatgaagtgatgacggcttttcctgagccatacaaaaaatggctagatatggat
aacaacattcgcatggactccaagctagagagctatgcaaagttgcgtcctgcctttgac
cgtcaatacggttcggtgaccgcagcaaactcaaccccactgacggatggcgccgccgcg
attatgttgatgcgtgaaggtaaagcgaaagagcttggtcttgagatcatggggtatatc
cgctcttatgcgtttgccgcgattggcgtagaaaaagatatgctgatggggccttcttat
gccactccgatagccttggatcgcgcaggcatcaccttaaatgatctcaccttgattgat
atgcacgaagcctttgccgcgcaaaccttagcgaacttgaagatgttcgccagtgacaag
tttgctcaagagcagctgggtcgcgcacaagcgattggtgaagtggacatgagtaaattt
aacgtgctgggtggctcactggcttatggtcacccattcgcggcgacaggtgcgcgtatg
atcactcaaactttgcgtgaattaaaacgccgtggcggtggtttagccttaaatacggct
tgtgctgcgggtggcttaggcgctgctatgattctggaggtggaataa

DBGET integrated database retrieval system