KEGG   Vibrio cholerae O49 1154-74: VAA049_2966Help
Entry
VAA049_2966       CDS       T03828                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter, ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    VAA049_2966 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vcx02000]
    VAA049_2966 (pstB)
Enzymes [BR:vcx01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     VAA049_2966 (pstB)
Transporters [BR:vcx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    VAA049_2966 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase SMC_N AAA_22 ABC_ATPase AAA_16 AAA_23 AAA_29 AAA_15 AAA_30 AAA_25 AAA_33 NB-ARC Rad17 Adeno_IVa2 ATP-synt_ab AAA_28
Motif
Other DBs
NCBI-ProteinID: AKB05028
UniProt: A0A085RFG2
LinkDB All DBs
Position
complement(3285390..3286211)
Genome map
AA seq 273 aa AA seqDB search
MYSANPTLGYYVPPLDVNNLTDQQTAISIEHLSLYYQQSRALSDISMRIPKGQVTAFIGP
SGCGKSTLLRCINRMNDLVEGTRVEGEVKLHGKNIYHPDVDVPTLRRRVGMVFQRPNPFP
KSIYENVVYGLRLQGIKNSRALDDAAEQSLRAAALWDEVKHRLHENAFGLSGGQQQRLVI
ARAIAIEPEVLLLDEPTSALDPISTLTIEELIHDLKTKYTVVIVTHNMQQAARVSDHTAF
IHMGKLIEYADTDSIFTSPLKKQTEDYITGRYG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtactccgccaatcctactttgggctattatgtgccgccgctggacgtgaataatctt
accgatcagcagacggcgatttcgattgagcacttaagcctgtattaccagcaaagtcgc
gccttgagtgatatttccatgcgtatccccaaaggtcaggttacggcgtttatcggcccc
tccggctgtggtaaatcgacgcttttgcgctgcattaaccggatgaacgatctggtggaa
ggaacgcgtgttgaaggtgaggtgaaattgcatggcaaaaacatctatcatccggatgtg
gatgtaccaacgctgcgccgccgagtcgggatggtattccagcgccctaatccctttcct
aaatcgatttatgaaaacgtggtgtatggactgcgtttgcaggggattaaaaatagccgt
gcgttagatgatgcggcggagcaatctctgcgtgcggcggcgttgtgggatgaagtcaaa
catcgtttgcacgaaaatgcatttggtttatcgggcgggcagcaacaacgtttggtgatt
gcccgtgcgattgcgattgaacctgaagtgttgcttcttgatgagccaacctcagcgctt
gatcctatctcgaccttgaccattgaagagctgatccacgatcttaaaaccaaatatacc
gtggttatcgtcactcacaacatgcagcaagcggcgcgcgtgagcgatcacaccgccttt
atccatatgggaaagttgatcgagtacgcagatactgactctattttcacgtcaccattg
aaaaagcaaaccgaagactacattacggggcgatacggttaa

DBGET integrated database retrieval system