KEGG   Vibrio cholerae O49 1154-74: VAA049_442
Entry
VAA049_442        CDS       T03828                                 

Definition
(GenBank) diguanylate cyclase domain protein
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VAA049_442
Enzymes [BR:vcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VAA049_442
SSDB
Motif
Pfam: GGDEF HAMP DUF4276
Other DBs
NCBI-ProteinID: AKB02847
LinkDB
Position
454284..455576
AA seq 430 aa
MTDQTRTSPLVNRLLKMISLCALGYLLIILAIIIPRGIQSVEQQKQELEEKLALSLSNSA
AIALYVNNYDIASEVMDALLLHKEINAVKLASVDGIVFERTTMPTTYKEQNYWSDANRYR
LDSPVDGNLIGYLMIHEDHQVVRQQAINQILDQIAVVLIQFLVTFIALIWIVRRLVGKPL
TDLSQALSEVRPDHDRKVAVAAEDHHNEIGLVAKSINEFIDASHQALLRERELRQQIERW
ESYYRTIAEQDTLTGLKNRLGCEKFVLRKQRASTTMVLLLIDLDGFKQVNDTLGHAAGDE
VLREIAKRFYALAQTHFSDFVVGRLGGDEFAIYIPLDEFVAESIERFAAQLIESSSEPIA
LGQQSAQVGCSIGISHMNSLHIDLEKLLLQADKAMYWVKYRGKHGYHIYRMGEEILPLPS
AKELKQDQFR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgactgatcaaacgcgcacttcgccactggttaatcgcttactaaagatgatttcactg
tgtgcgcttgggtatttgctgatcattttggccatcattattccacgcggcatacagagt
gttgagcagcaaaaacaagagctggaagagaagcttgcgctctctttgagtaactcggcg
gccattgcactgtatgtgaataattacgatattgcctccgaggtgatggatgcgctgctg
ctccataaagagatcaatgcggttaagttagccagcgtggatggcattgtctttgaacga
accaccatgcccacaacctacaaagagcagaattattggagtgatgcgaaccgctaccga
ttagattctcccgtagatggtaatttgattggctatctgatgattcatgaggatcatcag
gtggttcgtcagcaagccattaatcagattcttgatcagatagccgtggttttgatccag
tttctcgtgacttttattgcgcttatctggatcgttcgccgcttggtcggtaaacccctg
acggatctttcacaggcgttatcggaagtgcggccagatcatgatcgcaaagtggcggta
gccgcagaagatcaccacaacgagattggtttggtggccaaaagcatcaatgaatttatc
gacgcttcccatcaagctttactgcgtgaacgcgagctgcgtcaacagattgaacgttgg
gaaagctactatcgcaccattgccgaacaagacacgctgacgggactaaaaaaccgttta
ggttgtgagaagttcgtgctccgcaaacagcgtgctagcaccaccatggtgctgctattg
attgatttggatggttttaagcaggtgaatgataccttggggcatgcggctggcgatgag
gtattacgtgaaatcgccaaacgtttttatgccttggcgcaaacacatttttctgatttt
gtggtcggacggctcggtggcgatgagtttgctatttacattccgctggatgaattcgtt
gccgaatctatcgagcggtttgcggcgcagttgatcgaatcctcctctgagccgattgca
ttgggtcagcagagtgcgcaagtgggttgcagtatcgggattagtcatatgaacagtctg
cacattgacttagaaaaactgctgctacaagccgataaagccatgtactgggtcaaatac
agaggcaaacatggctatcatatttatcgaatgggggaagagatcctgcctcttcccagt
gctaaagaactcaagcaggatcagttcagatag

DBGET integrated database retrieval system