KEGG   Vibrio cholerae O49 1154-74: VAA049_792Help
Entry
VAA049_792        CDS       T03828                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx00020  Citrate cycle (TCA cycle)
vcx00190  Oxidative phosphorylation
vcx00650  Butanoate metabolism
vcx01100  Metabolic pathways
vcx01110  Biosynthesis of secondary metabolites
vcx01120  Microbial metabolism in diverse environments
vcx01130  Biosynthesis of antibiotics
vcx01200  Carbon metabolism
Module
vcx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vcx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vcx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VAA049_792 (sdhA)
   00650 Butanoate metabolism
    VAA049_792 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VAA049_792 (sdhA)
Enzymes [BR:vcx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VAA049_792 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     VAA049_792 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C OPA3
Motif
Other DBs
NCBI-ProteinID: AKB04491
UniProt: A0A0E4CD65
LinkDB All DBs
Position
839117..840826
Genome map
AA seq 569 aa AA seqDB search
MRAALQISEQGLTCALLSKVFPTRSHTVSAQGGITVALGNSHKDDWQWHMYDTVKGSDYI
GDQNAIEYMCKNGPESVIELERMGLPFSRFENGTIYQRPFGGQSKEFGGEQAARTAAAAD
RTGHALLHTLYQQNVKHKTTIFSEWYALDLVKNQDGAVLGCTAICMETGEICYFKAKATV
LATGGAGRIYASTTNAHINTGDGVGMALRAGVPMQDMEMWQFHPTGIAGAGVLVTEGCRG
EGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMIEIREGRGCDGPWGPHIKLKLDHLG
RDVLESRLPGICELSRTFAHVDPVKEPIPVIPTCHYMMGGVPTQVSGQAIKQDSHGKDVE
VQGLFACGEIASVSVHGANRLGGNSLLDLVVFGRATGLHLGETLRAQAEARPATASDIEA
SLARTMRWENSKGGEDPVVIRKDLQRCMQNNFSVFREGKAMAEGLEELKVIRERLKNAHL
ADKSTEFNTQRIECLELDNLMETAFSTAVAANYRTESRGAHARFDYPERDDENWLCHSIY
NPETEQMSKREVNMTPVYRDPFPPKVRTY
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgcactacaaatttctgagcaaggcctaacttgcgcactgctttcaaaagtg
tttccaactcgttctcatacggtatccgctcaaggcggcattactgtggctttgggtaac
tcacataaagatgattggcagtggcatatgtatgacacggtaaaaggttccgactatatc
ggcgaccaaaatgccatcgaatacatgtgtaaaaacggtccggaatccgtgattgaactt
gagcgcatggggttgcctttttctcgttttgagaacggcacgatttatcagcgtcctttt
ggcggtcagtcaaaagagttcggtggtgaacaagctgctcgtacggcagcagcagcagac
cgtactggtcatgctctactgcacacgctttaccaacaaaacgttaaacataaaaccacc
attttctcggaatggtatgcactggatctggtgaaaaaccaagatggtgctgtgctcggt
tgtactgcaatctgcatggaaacaggcgaaatttgctacttcaaagccaaagcaacagtg
cttgcgacaggcggtgcaggtcgtatttacgcttcaactaccaacgcacacattaacaca
ggcgatggtgtcggtatggctttgcgtgctggcgtaccaatgcaagatatggaaatgtgg
caattccacccaacgggtatcgcgggtgctggcgttctggttacagaaggctgtcgtggc
gaaggcggctatctgctgaataaagatggtgaacgtttcatggaacgctacgcgccgaat
gccaaagacttggccggtcgtgacgtggttgcacgttcaatgatgatcgaaatccgtgaa
ggtcgtggctgtgacggcccttggggcccacacatcaaactgaaactggatcacttaggt
cgtgatgtattggaatctcgcctaccgggtatctgtgaactatcacgtacctttgctcac
gtggacccagtgaaagaacctattcctgttatcccaacctgtcactacatgatggggggg
gtaccaacgcaagtgtctggtcaagcgatcaaacaagacagccatggaaaagatgtcgaa
gtccaaggcttgtttgcttgtggtgaaatcgcttctgtatcggtacatggtgccaaccgt
ttaggcggcaactcactgcttgatctggtggtatttggccgcgcaacgggtctacatctt
ggtgaaactctgcgtgctcaagctgaggctcgccctgcgactgcatcggatatcgaagct
tctctggctcgtactatgcgctgggaaaacagcaaaggtggcgaagacccagttgttatc
cgtaaagatctgcagcgctgcatgcaaaacaacttctcggtattccgtgaaggtaaggcg
atggctgaggggctggaagagctcaaagtcattcgcgaacgtttgaaaaatgcccatctg
gcggacaaatcaaccgaatttaacactcaacgtattgagtgtttagagttggacaacctg
atggaaacagcattttcgaccgcagtagcggcaaactaccgtactgaaagccgtggtgca
catgcgcgttttgactatccagagcgtgatgatgagaactggttgtgccactcaatctac
aatccggaaacggaacagatgagtaagcgtgaggtcaatatgactccggtttaccgtgac
ccgttcccgcctaaagtgcgtacatattaa

DBGET integrated database retrieval system