KEGG   Vibrio cholerae O49 1154-74: VAA049_793Help
Entry
VAA049_793        CDS       T03828                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx00020  Citrate cycle (TCA cycle)
vcx00190  Oxidative phosphorylation
vcx00650  Butanoate metabolism
vcx01100  Metabolic pathways
vcx01110  Biosynthesis of secondary metabolites
vcx01120  Microbial metabolism in diverse environments
vcx01130  Biosynthesis of antibiotics
vcx01200  Carbon metabolism
Module
vcx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vcx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vcx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VAA049_793
   00650 Butanoate metabolism
    VAA049_793
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VAA049_793
Enzymes [BR:vcx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VAA049_793
    1.3.5.4  fumarate reductase (quinol)
     VAA049_793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4_4 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AKB04303
UniProt: A0A085SWA7
LinkDB All DBs
Position
840841..841551
Genome map
AA seq 236 aa AA seqDB search
MKLNFSLYRYNPDVDNKPYMKDYILEVEEGSDMMVLDALILLKEQDPSIAFRRSCREGVC
GSDGLNMNGKNGLACITPLSALKGDKIVIRPLPGLPVVRDLIVDMTQFYDNYAKVKPFLI
ADDALPPSRENLQSPEERAHLDGLYECIMCACCTTSCPSFWWNPDKFIGPAGLLAAYRWL
IDSRDTATDERLSNLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLINRSV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaacttctctttatatcgctataatccggatgtcgataacaaaccctacatg
aaagactacattcttgaggtagaggaagggtctgacatgatggtgttggatgctttgatt
ctgcttaaagagcaagatccaagtattgctttccgccgctcatgccgtgaaggggtttgt
ggctcggacggtctgaatatgaatggtaagaatggcttagcatgtatcacacctttgtct
gcgttaaaaggtgacaaaattgtgattcgtccactgccaggattacctgtggttcgtgac
ttgattgtcgacatgactcagttttacgataactatgcgaaagttaagcctttcttgatt
gcagatgatgcattacccccttcaagagagaacttgcaatccccagaagaacgggcgcat
ttggatggtctgtacgagtgtattatgtgcgcttgctgtaccacttcctgtccttcattc
tggtggaatccggataaatttatcggacctgcaggtttgttggctgcttatcgttggttg
attgatagccgtgataccgcgacagatgaacgcttatcgaatcttgatgatgcgtttagc
gtttttcgttgccacggcatcatgaactgtgtcagtgtttgtccgaaaggattaaaccca
acgaaagccattggacatattaagtccatgttgatcaatcgttcagtttaa

DBGET integrated database retrieval system