KEGG   Vibrio cholerae O49 1154-74: VAA049_902Help
Entry
VAA049_902        CDS       T03828                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vcx  Vibrio cholerae O49 1154-74
Pathway
vcx00220  Arginine biosynthesis
vcx00250  Alanine, aspartate and glutamate metabolism
vcx00290  Valine, leucine and isoleucine biosynthesis
vcx01100  Metabolic pathways
vcx01110  Biosynthesis of secondary metabolites
vcx01130  Biosynthesis of antibiotics
vcx01210  2-Oxocarboxylic acid metabolism
vcx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vcx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VAA049_902
   00290 Valine, leucine and isoleucine biosynthesis
    VAA049_902
   00220 Arginine biosynthesis
    VAA049_902
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vcx01007]
    VAA049_902
Enzymes [BR:vcx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VAA049_902
    2.6.1.66  valine---pyruvate transaminase
     VAA049_902
Amino acid related enzymes [BR:vcx01007]
 Aminotransferase (transaminase)
  Class I
   VAA049_902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AKB04436
UniProt: A0A085SZD7
LinkDB All DBs
Position
complement(960777..961991)
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQYYQKKGIRSLDVEDVYIGNGASELIVMAMQALLNNGD
EMLVPAPDYPLWTAAVALSGGKAVHYICDEEADWYPDLDDIRSKITPKTRGIVLINPNNP
TGAVYSRDFLLEIIEIARKHKLMIFADEIYDKVLYDGAVHTSIATLADDVLVVTFNGLSK
AYRVCGFRGGWMFLTGPKQQAQGYIAGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINQIPGISCVKPKGAMYLFPKIDTKMYPIKDDQKMVLDFLVQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEIAISRFERFITTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgataatgtctgctatgacattcgaggacca
gtgcttaaacatgctaaacgcatggaagaagaagggcataaaatactgaagcttaacatc
ggtaaccctgccccgtttggtttcgacgccccagacgagatcctagtcgatgtgatccgt
aacctacctacttcacaaggttactgtgactcgaaaggcatttattccgctcgtaaagcg
gtggtgcagtactaccagaaaaaaggtatccgcagtctggacgtcgaagatgtgtacatc
ggcaacggtgcatcagagcttatcgtgatggcgatgcaagccctgctcaacaatggcgat
gaaatgctggtacctgcccctgattacccactgtggacagccgcggtagcactttctggc
ggcaaagccgtgcactacatctgtgacgaagaagccgattggtatcctgacctcgatgat
attcgcagcaaaatcaccccgaaaacccgtggcattgtgctgatcaaccccaataaccca
accggtgcggtttacagtcgtgatttcttgctggaaatcatcgagattgctcgcaagcac
aagctgatgattttcgccgatgagatttacgacaaagtgctgtacgacggcgccgtgcat
acctcaatcgccaccttagcggatgatgtattagtcgtcaccttcaacggcttatccaaa
gcttaccgtgtttgtggtttccgtggtggctggatgttcctgactggccccaaacagcaa
gcacaaggctacattgcagggcttgatatgctggcctcgatgcgcttgtgtgccaacgtg
ccaatgcaacatgcgattcaaacggcgcttggcggctatcaaagcatcaatgagctgatt
ttgccgggtggtcgattgctggagcaacgtgatcgcgcatgggagctgattaaccagatc
ccggggatttcttgcgtgaagccaaaaggcgcgatgtacctgttcccgaaaattgatacc
aagatgtatccgatcaaagatgaccagaaaatggtgcttgatttcctagtgcaagaaaaa
gtgctgctggtacaaggtagtggttttaactggccaaaaccggatcacttccggattgtg
actctgccacatgtggaagatctggaaatcgccatcagtcgctttgaacgctttatcacc
acttacagccaataa

DBGET integrated database retrieval system