KEGG   Vibrio coralliilyticus RE98: IX92_00710Help
Entry
IX92_00710        CDS       T03444                                 

Gene name
cyaA
Definition
(GenBank) adenylate cyclase
  KO
K05851  adenylate cyclase, class 1 [EC:4.6.1.1]
Organism
vcy  Vibrio coralliilyticus RE98
Pathway
vcy00230  Purine metabolism
vcy01100  Metabolic pathways
vcy05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vcy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    IX92_00710 (cyaA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    IX92_00710 (cyaA)
Enzymes [BR:vcy01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     IX92_00710 (cyaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylate_cycl Adenyl_cycl_N PIN_6
Motif
Other DBs
NCBI-ProteinID: AIW17658
LinkDB All DBs
Position
1:149455..151983
Genome map
AA seq 842 aa AA seqDB search
MQAYTKTLIQRLDNLNQQRIERALALMDLQSQRVFHLIPTLLHFNHPVIPGYYDSQVPFG
VYGLEFNEVQQQFVEDTELTIGQSLRTCAEPAILGLYTMGSTSSIGQSTSSDLDIWVCVS
PSMSCEERECLTNKCLLITDWAQTQGVEANFFLMDEERFRTNRSEEMTGDNCGSSQHLLL
LDEFYRSAVRLAGQRLLWQIVPPEMEECYDEYVRDLCSQGYIDCSQWIDFGQLNRIPAEE
YFGSNLWQLYKSIDSPYKSVLKAILLEAYSWEYPHTQLLSIDTKRRFFAHEPDLYGMDAY
YLMLEKVTRYLERIGDYTRLDLVRRCFYLKTHEKLSREPGIGSVAWRREAMSDMIQKWYW
DQSVLVELDDRRNWKVEQVKVVHHALLDALMLSYRNLIQFARRNDITSAISPQDISILAR
KLYAAFEVLPGKVTLLNPQISPDLHESDLSFIEVRPGRTNRAGWYLYKQPLQPDRILGQP
FLEHNEYLSKLVAWSFFNGLITESTRLHSVVRDAHLDIDKFYQMVSDLRNTFSLRKRRPT
MQALASPCEISQLAMFINFEDDPTAELSGRALKVDLKTTDIFSFGSKQTCLVGSVDLVYR
NSWHEVRTLHFRGETAMLDALKTILGKMHQDALPPESVDVFCYSKNLRGVMRNMVYQLLA
ECIDLRLKPIEQEKRRRFKALRIAQQTYGLFFERRGVSVQMLENSVDFYRSISTSKLKGS
PLLMLDKEQDYQLPEIVDSFASEGLIQFFFEDSDQGFNIYVLDEANRVEVYHQFSGMKDE
MIASVNSFYTSVKDDNQMSTQFINFNLPQYYQIVHPAEGDSYIVPYRNDGANYSKPSRAV
NA
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggcttatacaaagacgcttattcagagacttgataacctaaaccagcagcgtatt
gagcgcgcgctggctcttatggatttgcaaagtcagcgtgttttccatctgattcctacc
cttcttcacttcaaccacccagtcatccccggctattacgattctcaagttccttttggt
gtatacggtctcgaattcaatgaggtgcaacagcagtttgttgaagatactgaactgacg
ataggtcagtcgcttcgtacctgtgcagagcctgccattctcggcttatatactatgggc
agtacttcgtcgattggacagagtacctcaagcgatcttgatatctgggtgtgtgtctcg
ccatcaatgagctgtgaagaaagagagtgcctgaccaataagtgcttgttgattaccgat
tgggctcagactcaaggcgttgaggcgaatttcttcctgatggatgaggagcgttttcgc
accaatcgctcagaagaaatgaccggtgacaactgtggttcatcccaacacttattacta
ttagatgaattctatcgctctgccgttcgtcttgctggtcagcgtttgctgtggcaaatc
gtgccgcctgagatggaagagtgctacgacgaatacgttcgcgatttatgtagccaaggc
tacattgattgctcgcaatggattgactttggtcagctgaaccgcattccagccgaagag
tattttggctcgaacttgtggcagttgtataagagtatcgattcaccttacaagtcggtg
ctaaaagctatcctacttgaagcgtattcgtgggagtacccacatacccaactgcttagc
attgacactaagcgtcgattctttgcccatgagcctgatctctatggcatggatgcgtac
tacttgatgctagaaaaggtaacacgttaccttgagcgtattggcgattatacccgtctt
gatctggtgcgccgttgtttctatctcaaaacacacgagaagttatcacgtgagcctggt
attggctctgttgcttggcgccgtgaggcgatgagtgacatgatccagaaatggtactgg
gaccaatcagtgctggttgagctagacgaccgccgtaactggaaagtagaacaggttaaa
gtggttcaccatgctttgttagatgcgcttatgctgagctatcgcaatctgattcagttt
gcgcgtcgtaacgacattacgtctgcaatcagtccgcaagacatcagtatcttggcgcgt
aagctctatgcggcgtttgaggtgttgccgggtaaggtgacgttgctcaatccacaaatt
tcgccagacttgcatgagtccgacttaagctttattgaagtgaggccggggcgcacaaac
cgagctggctggtacctctataagcaacctcttcagccagatcgcatccttggtcagcca
ttcttagagcacaatgaatacctcagtaagttggtcgcttggtcattcttcaatggccta
attacagaatcgacgcgtctgcactcggtagttcgtgatgctcatctggatatcgataag
ttctatcagatggtcagcgatttgcgtaataccttctcattgcgcaagcgccgcccaact
atgcaggcattagcgagcccttgtgaaatcagccaactggcgatgttcatcaactttgaa
gatgatccaacggctgagctgagtggccgcgcgctgaaagtggacctgaaaactaccgat
atttttagttttggctcaaagcaaacttgtctggttggtagcgtggacttggtttatcgc
aactcttggcatgaagtgcgtacgttgcatttccgaggtgagactgcgatgctggatgca
ctgaagaccattctgggtaagatgcaccaagatgcgttgccgcctgagtcggtagacgtg
ttctgctacagtaaaaacctgcgtggcgtgatgcgtaatatggtgtatcagcttttagcg
gaatgcattgatttgcgccttaagccgattgagcaagagaaacgtcgccgctttaaagcg
ctgcgtattgcccaacaaacgtatggcttgttctttgagcgccgcggtgtgtctgtacag
atgctggaaaactcggtcgatttctaccgcagcatctcgaccagtaaactcaaaggttca
ccattgctgatgctggacaaggaacaagattaccagctgccagaaatagtcgacagtttt
gccagtgaaggtctgattcagttcttctttgaagattcagatcaaggcttcaatatctat
gtattggatgaagcgaaccgtgtcgaggtgtaccaccagttcagtggcatgaaagatgag
atgattgccagcgtgaacagcttctatacgtcggttaaagatgataaccaaatgtcgact
cagtttattaacttcaacctgcctcagtactatcaaatcgttcaccctgcagaaggtgac
tcttacatcgtgccatatcgtaatgatggcgcgaactattccaagccaagtcgggccgtg
aatgcgtaa

DBGET integrated database retrieval system