KEGG   Vibrio coralliilyticus RE98: IX92_04400Help
Entry
IX92_04400        CDS       T03444                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vcy  Vibrio coralliilyticus RE98
Pathway
vcy00220  Arginine biosynthesis
vcy00250  Alanine, aspartate and glutamate metabolism
vcy00290  Valine, leucine and isoleucine biosynthesis
vcy01100  Metabolic pathways
vcy01110  Biosynthesis of secondary metabolites
vcy01130  Biosynthesis of antibiotics
vcy01210  2-Oxocarboxylic acid metabolism
vcy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vcy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IX92_04400
   00290 Valine, leucine and isoleucine biosynthesis
    IX92_04400
   00220 Arginine biosynthesis
    IX92_04400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vcy01007]
    IX92_04400
Enzymes [BR:vcy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     IX92_04400
    2.6.1.66  valine---pyruvate transaminase
     IX92_04400
Amino acid related enzymes [BR:vcy01007]
 Aminotransferase (transaminase)
  Class I
   IX92_04400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIW18329
LinkDB All DBs
Position
1:complement(965866..967080)
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYIGNGASELIVMAMQALLNNGD
EMLVPAPDYPLWTASVALSGGKAVHYLCDEQADWYPDLDDIRKKITPKTRGIVLINPNNP
TGAVYSRDFLLEVIEIARQHKLIIFADEIYDKVLYDGATHTSVATLSDDVLTVTFNGLSK
AYRVCGFRGGWMFLTGPKHLAQGYVNGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAYELINQIPGVSCVKPKGAMYLFPKIDTKMYNIKDDQKMVLDFLIQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEMAIGRFERFLSTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgataatgtctgctatgacattagggggcct
gtactcaaacatgctaagcgcatggaggaagaggggcataaaatactgaagttgaatatc
ggtaatcccgccccatttggatttgacgccccagatgaaatcttggttgatgtcattcgc
aacctaccgacttcacaaggttactgtgactcgaaaggcatctactctgctcgtaaagcc
gtcgttcagcactatcaacgtaaaggcatccgttctttagatgtcgaagacgtgtatatc
ggtaatggcgcatcagaactgatcgttatggcgatgcaggctttgctcaacaatggcgat
gagatgctggtccccgctccggattacccgctttggacagcgtctgttgccctatctggc
ggaaaagccgtgcattacctttgtgatgaacaagcagactggtacccagatctagatgat
attcgcaagaaaatcacccctaagacccgtggtattgtcttaattaaccccaacaacccg
acaggtgcagtctatagccgcgactttttattagaagtgattgagattgcccgacagcac
aagctaatcatcttcgctgatgaaatttacgataaagtactctatgacggcgccacacac
acgtctgttgcaacactctcagatgatgttcttactgttacctttaacggcttatctaaa
gcttatcgcgtctgtggtttccgtggtggctggatgttcctcaccggcccgaaacatctc
gctcaaggatacgtaaatggcttggatatgctggcttcaatgcgtttgtgtgccaatgta
ccgatgcaacatgcaattcagaccgcactgggtggctatcagagtattaatgaactgatc
ctgcccggcggccgcttattggaacagcgtgaccgcgcctatgaactgatcaatcaaatc
ccgggggtttcctgcgtgaaacctaaaggcgcgatgtatctgttcccgaaaatcgacacc
aagatgtacaacatcaaagatgatcaaaagatggttctcgacttcctgattcaggagaaa
gttctgttggttcaaggctcaggcttcaactggccaaaacccgatcacttccgcattgtg
accctgccacacgttgaagatctcgaaatggcgattggacgctttgaacgattcctgtcg
acgtatagccagtag

DBGET integrated database retrieval system