KEGG   Vibrio coralliilyticus RE98: IX92_05035Help
Entry
IX92_05035        CDS       T03444                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vcy  Vibrio coralliilyticus RE98
Pathway
vcy00250  Alanine, aspartate and glutamate metabolism
vcy00410  beta-Alanine metabolism
vcy00430  Taurine and hypotaurine metabolism
vcy00650  Butanoate metabolism
vcy01100  Metabolic pathways
vcy01110  Biosynthesis of secondary metabolites
vcy01120  Microbial metabolism in diverse environments
vcy02024  Quorum sensing
Module
vcy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    IX92_05035
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IX92_05035
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IX92_05035
   00430 Taurine and hypotaurine metabolism
    IX92_05035
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    IX92_05035
Enzymes [BR:vcy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     IX92_05035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DUF5446 HSCB_C
Motif
Other DBs
NCBI-ProteinID: AIW18445
LinkDB All DBs
Position
1:complement(1133623..1135269)
Genome map
AA seq 548 aa AA seqDB search
MVSEHKTADASFESLLRIFTVPEGPDSTLTKIEEKLSQNLNQFLREHIVAEEKPLREIEK
DFSNASLPEQPEFVSEHTQHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLVYNQNDEFYAKWMHSANHSLGAFCSGGTIANITA
LWVARNNALKAQGDFKGVEKEGLFKAMKHYGYEGLAVLVSERGHYSLKKAADVLGIGQEG
LVAIKTDANNRICPQALQEKISQLKQQNIKPFAVIGVAGTTETGSIDPIADIAAICQRES
CHFHIDAAWGGATLMSNNYRHLLDGVELADSITVDAHKQLYIPMGAGMVLFKDPEAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKAKYFAEL
IKQQNDFELVSEPELCLLTYRYIPAEIRNALEKADPKQKSELNELLNELTKFIQKRQRET
GKSFVSRTRLNPELWDRMNTIVFRVVLANPLTGRDILSMVLEEQREIAKQAPKLMARIQF
AAQKIKEN
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggtatcggaacataaaacggctgacgcaagtttcgagagtttactccgaatctttacc
gtccctgaagggccagactcaacactgacaaaaatcgaagaaaagttatcgcaaaacctg
aaccagtttttgcgcgaacatatcgtcgcggaagaaaaaccacttagagaaatcgaaaaa
gacttctccaatgcgtcacttccagagcaacccgaattcgtttccgagcatactcaacat
ttgcttgataccctagtatcacattcagttcatacttctgcaccgagctttatcggccac
atgacttcggcactgccctactttttgatgccactgtctaagatcatgatcgcgctcaat
caaaacttggtcaaaatcgaaacatccaaagctttcacacctttagagcgccaagttctg
ggtatgcttcaccgactggtatacaaccaaaacgatgagttttacgctaaatggatgcac
agtgctaatcactctctgggcgctttttgttctggcggaactatagccaacattacggca
ctttgggtggcgagaaacaacgcgttaaaagcgcaaggtgatttcaaaggtgtagaaaaa
gaaggactattcaaagccatgaaacattatggttatgaaggtcttgctgtattggtctct
gaacgcggtcactattcattgaaaaaagcagcggatgttcttggcatagggcaagaaggt
ctggttgccattaaaacagatgccaataatcgtatctgccctcaagcgctgcaggaaaaa
atatctcaacttaaacagcaaaacatcaagccttttgcagtgattggtgttgccggtaca
acagagactggctcgattgacccaattgccgatatcgcggctatttgtcagcgtgaaagt
tgccatttccatattgatgccgcatggggcggtgcgacactgatgtctaacaactaccgt
cacctcttggatggcgtagagttagcagactcgataaccgttgacgctcacaaacagctc
tacatcccgatgggtgcgggcatggtgttgtttaaagatcctgaagcgatgaaatctatc
gagcaccacgcacaatatatcttgcgtaaaggttcgaaagacctaggcagccacacgcta
gaaggctctcgttctggtatggccatgctggtttatgccgcgatgcatatcatcagtcgc
cctggttacgagctactgatcgatcagagtattgaaaaagcaaaatacttcgccgagttg
atcaaacagcaaaacgatttcgaactcgtttcagaaccagaactgtgcttactgacctat
cgatacattccagctgagatccgcaacgcgcttgagaaagccgatccaaaacagaaatcg
gaattgaacgagctgctcaatgagctgacaaagttcattcagaaacgacaacgcgaaaca
ggtaagtcttttgtttctcgaactcgcctcaaccccgagctgtgggacagaatgaatacc
attgtattcagagttgttctggctaatccccttactggacgagacatcctgagcatggtt
ctcgaagagcagcgagagattgcaaaacaagcaccaaaattgatggcgaggatccaattc
gccgctcaaaaaatcaaagaaaactga

DBGET integrated database retrieval system