KEGG   Vibrio coralliilyticus RE98: IX92_07085Help
Entry
IX92_07085        CDS       T03444                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vcy  Vibrio coralliilyticus RE98
Pathway
vcy00473  D-Alanine metabolism
vcy01100  Metabolic pathways
vcy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vcy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IX92_07085
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    IX92_07085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcy01011]
    IX92_07085
Enzymes [BR:vcy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     IX92_07085
Peptidoglycan biosynthesis and degradation proteins [BR:vcy01011]
 Precursor biosynthesis
  Racemase
   IX92_07085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIW18822
LinkDB All DBs
Position
1:complement(1562474..1563691)
Genome map
AA seq 405 aa AA seqDB search
MVFRATLVSLAVASALFPMSSIAAPIALPDTPPAMNQVQQSNAWLEISLGQFKQNMAQFR
SHLSSQTKLCVVMKADAYGNGIRGLMPTILELNVPCIAIASNAEARTVRDSGFEGQLVRV
RSADIQEIEQAMDLDIEELIGSLEQANQIKSLSTDKTIKVHLALNDGGMSRNGIDMSTEK
GKQEALDIAKHQGIDIVGIMTHFPNYDADEVRSKLADFNQSSAWLIENANLNRNDVLLHV
SNSYTALNVPEAQLDMVRPGGVLYGDLPTNPEYPSIVSFKTRVASLHNVPANSTVGYDSS
YVTKRDSVLANLPVGYSDGYPRKMGNRAHVIVNGQRAPVVGKTSMNTTMVDVTDVKGVIT
GQEVTLFGQQANAQISVGEMEEHAELIFPELYTVWGTANPRLYIP
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggttttccgcgcaacactggtttcacttgcagtcgcgtctgcactatttccaatgagc
tccatcgctgcacctatagcgttgcctgacacgccgccagcaatgaatcaagtacagcaa
tcgaacgcatggcttgagattagcctaggtcaattcaaacaaaacatggcccagtttcgc
tcccatctcagcagtcaaacaaagctttgtgtggtgatgaaggccgatgcctatggtaat
ggaatacgcggcttaatgccgaccattcttgagctcaatgtcccttgcatcgcaatcgca
agtaatgctgaggcgaggactgttcgagatagtgggtttgaaggccagttagttcgtgtt
cgatctgctgatattcaggaaattgaacaagccatggatcttgatattgaagagcttatc
ggcagcttggagcaggcgaatcagatcaaatctctaagcacagacaaaacaatcaaagtc
catttagcgttgaatgatggcggcatgtctcgaaatgggattgatatgagtaccgaaaaa
ggtaagcaagaagcacttgatattgcgaagcaccaaggcatcgatatcgtgggcatcatg
acgcatttcccaaattatgatgctgacgaagtgagaagcaaactcgccgatttcaatcaa
agctcagcatggctgatcgaaaacgctaacttgaataggaatgatgttttactccatgta
tcaaactcttatacagcattgaacgttcctgaagcgcaactggatatggtgagacccggc
ggggtactgtatggcgatctgccaactaacccggaatatccctcaattgttagtttcaaa
actcgagtcgcgtctttacacaatgttcctgccaattctaccgtcggctatgacagtagc
tacgtgaccaaacgtgacagtgtattggccaatttacccgtagggtactctgatggttac
ccgagaaaaatgggtaaccgagcccatgtcatagtgaatgggcaacgtgctccggttgta
gggaaaacatcgatgaacacgacgatggtagatgttactgatgttaaaggtgtaattacg
ggacaagaagtcacactgtttggccaacaagcgaatgcacaaatcagtgtcggagaaatg
gaagaacatgctgaattgatattcccagagctttataccgtttggggaacggccaatcca
aggctttacataccgtaa

DBGET integrated database retrieval system