KEGG   Vibrio coralliilyticus RE98: IX92_12795Help
Entry
IX92_12795        CDS       T03444                                 

Definition
(GenBank) peptidase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
vcy  Vibrio coralliilyticus RE98
Pathway
vcy00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vcy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IX92_12795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:vcy01003]
    IX92_12795
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcy01011]
    IX92_12795
Enzymes [BR:vcy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     IX92_12795
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     IX92_12795
Glycosyltransferases [BR:vcy01003]
 Polysaccharide
  Bacterial polysaccharide
   IX92_12795
Peptidoglycan biosynthesis and degradation proteins [BR:vcy01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   IX92_12795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AIW19872
LinkDB All DBs
Position
1:complement(2783111..2785471)
Genome map
AA seq 786 aa AA seqDB search
MTKKKTPASSKTKTTKKPARKRATARRKPTQKGQRSWLKIVWGVTWKLGLAGFALLLFVG
IYLDSVVKQRFEGQLFDLPTVVYARILNLSPGDSISIQEVRNELDVLNYRKVRQPRYPGE
YSSSSTKIELIRRPFEFTDGPEPDRHVMLHFDRSGLLRIQSLESSGDLGYLRIEPKMLGM
LEKNHDEQRLFLRRDQFPEVMVDALLATEDRDFYQHDGVSPFAIARALVANLKAGRTVQG
GSTLTQQLAKNIFLSSDRTLWRKIREAYIALIIDYRYSKDRILEGYLNEVYLGQSRGEAI
HGFGLASRLYFGQPIQELRIDQLALLVGMVKGPSYYNPVRFPERAKERRDLVLRLMMQQG
ILSANQYDMAASRPLDIQDNPRIASRQPAYFQQLKIELKEKVGDAFQSDIGLRVFTSLDP
VSQQELEQAIAKKIPQLSKVAGKSLEGAAIAVDRHTGEIRAMVGGKRTGYDGFNRALNAS
RQIGSLAKPAVYLTALEQPDKYNLATTLHDKPISLKGSKGSVWSPRNYDRKFRGDVPLYI
ALAKSLNVPTVQLGMQLGIPNVVNTLEKLGVDRNEIRPVPSMFLGSFTLTPFQVAQMYQT
LTNSGKRAPLSALRSVVDLEGNALYQSLPRMSQTIDQQAAWLTTYAMKRGVLEGTGRYLN
SQFGWAALAGKTGTSNDTRDSWFVGVDGREVTTIWLGRDDNKPTKLTGSSGALRVYAEYL
NHRIPEKLTLPWPKGISTLGFSHTEQGSLQLDCDNQFKLPVWDTNNVLKQQCDSKPTQWI
KKIFSW
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaaaaaaacaccggcgagcagcaaaactaaaacaaccaagaaacctgctcgc
aaacgggcgacagcgagacgcaagccaacccaaaaaggccaacgtagctggttgaaaatt
gtatggggagtgacctggaagcttggtcttgctgggtttgccttactgctgtttgtcggt
atttacctagacagtgtggttaaacagcgtttcgaaggccagctgtttgatctgccgacc
gtggtttacgctcgcattcttaacctttctccgggtgattcgatttcgattcaggaagtt
cgcaacgaactcgatgtgctcaactaccgtaaagtacgccagcctcgttatcctggtgag
tattcgtcgtcgtcaaccaaaattgaactgattcgccgtccgtttgagtttactgatggg
ccggagcctgatcgtcatgtgatgctgcattttgaccgttctggcttacttcgtattcag
tcgctcgaatcctccggtgatctgggctatttgcggatcgagccgaagatgttgggcatg
ctggagaagaatcatgatgagcagcgtctattcttgaggcgagatcagtttcctgaagtc
atggttgatgcattactggctaccgaagaccgagacttttatcagcatgatggagtctca
ccgtttgcgattgcccgagcattagttgccaatctcaaagcaggtcgcacggtacagggg
ggcagtaccctgactcagcagctcgcgaagaacattttcctttcgagtgatcgaacgttg
tggcgtaagatccgtgaagcctatatcgcattgatcattgattaccgctacagcaaagac
cgcattctggaaggttacctgaatgaagtatatttagggcaaagccgtggggaagccatt
cacggctttgggctggcttcccgcttatactttgggcagccgattcaagaactacgcatt
gaccagctcgcattactggtgggtatggtaaaggggccatcctactacaacccggtacgc
tttcctgagcgagccaaagagcgtcgagatttagtgcttcgtctgatgatgcagcagggg
atcttgagtgctaaccagtacgacatggcagctagtcgcccgctggacattcaggataac
cctcgtattgctagccgtcagccggcttactttcagcagttgaagattgagctgaaagag
aaagttggtgatgcgtttcagtcggacattggtctcagggtgtttacatctctcgatccg
gtttctcaacaagagctggaacaggccattgccaagaaaatacctcagcttagcaaagtc
gcaggcaagtcactcgaaggggcagcgatcgccgttgaccgccataccggtgaaattcgc
gctatggtcgggggtaaacgaacagggtacgacggattcaatcgtgcgcttaacgccagt
cgtcaaattggatcgttagccaaaccagcagtctatctcaccgctttggagcagcctgac
aaatacaatctggctacgactttgcacgataaaccgatcagccttaagggttcaaaaggc
agtgtttggtcgccgcgcaactatgaccgtaagtttcgaggggacgtgcctttgtacatt
gcattggcaaaatctctcaacgtaccgacagtgcagctaggtatgcagctcggcattcca
aatgttgtcaatactttggagaagttgggtgttgaccgaaatgaaattcgtcctgtgccg
tcaatgttccttggttccttcacattaacgccattccaggtcgcgcagatgtatcagacg
ttgaccaattcgggtaagcgggcgcccttgtctgcgctacgttcggtggtcgatttagaa
ggtaatgcgctgtatcagtcactgccgcgaatgtctcaaactatcgaccagcaagcagct
tggctgacgacctacgctatgaaacgcggcgtcttagaaggcactggccgttatctcaac
agccagtttggctgggcggcgttagctggaaaaacgggaaccagtaacgatacgcgtgac
agctggtttgttggtgtcgatggacgcgaagtaacaactatctggcttggtcgagatgat
aataagccaacaaaacttacgggttccagcggtgcgttacgagtctatgcagaatatctc
aaccaccgcataccggaaaaactgacgttaccttggccaaagggaatcagtactcttggt
ttttctcatactgaacaaggcagcctgcaactggactgcgataatcagtttaagctgcca
gtttgggacacaaacaatgtgctcaagcagcagtgtgacagcaaacccactcaatggatt
aagaaaatatttagttggtaa

DBGET integrated database retrieval system